KEGG   Altererythrobacter marensis: AM2010_366Help
Entry
AM2010_366        CDS       T03951                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
amx  Altererythrobacter marensis
Pathway
amx00970  Aminoacyl-tRNA biosynthesis
amx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amx00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AM2010_366
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:amx03029]
    AM2010_366
Enzymes [BR:amx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AM2010_366
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AM2010_366
Mitochondrial biogenesis [BR:amx03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AM2010_366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AKM06454
UniProt: A0A0G3X764
LinkDB All DBs
Position
380371..381870
Genome map
AA seq 499 aa AA seqDB search
MMSTYRIQGATGEWEVVIGLEVHAQVTSNAKLFSGSSTAFGAEPNTQVSLIDAAMPGMLP
VPNRECIRQAVRTGMAIEAQINAWSRFDRKNYFYADLPQGYQISQLYHPLVGEGSLTIEA
DEKAGIPEDKVIGIERIHVEQDAGKLMHDQHPTMSYVDLNRCGVALMEIVSRPDMRSPAE
AGAYVRKLRTILRYVGSCDGNMEEGSMRADVNVSVRKPGEEFGTRTETKNVNSVRFVMQT
IEHEARRQVDLIEDGGTVVQETRLFDPGTGTTRSMRSKEDAHDYRYFPDPDLLPLELEQA
FLDECRASLPELPDAKRRRYVETLGLSEYNARELTAEVETFARFETLLAATAKGIGKSES
EVATQVANWSLSVAPGVINALGDEANPAHATAEAQAAILDMQARGEISGGQAKEIFEIVL
KTGREPGEIAESEGLKQVSDTGAIEAAIDKILANNTDKVEEYRGGKDKLFGFFVGQTMKA
MQGKANPAVVNQLLKAKLG
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgatgagcacttatcgcatccagggcgcaaccggcgagtgggaggtcgtgatcggcctg
gaagttcacgcgcaggtcacgtccaacgccaagctcttttccggctcctccaccgctttc
ggggcggagccgaacacgcaggtcagcctgatcgatgcggcaatgccgggaatgctgccg
gtgccgaaccgcgaatgcatccgccaggcggtgcgcaccggcatggcgatcgaggcgcag
atcaacgcgtggagccggttcgaccgcaagaactacttctacgccgacctgccgcaggga
tatcagatttcgcagctctatcatccgcttgtcggcgaaggttcgctgacgatcgaggcg
gacgagaaggccggcattcccgaagacaaggttatcgggattgagcgtatccatgtcgaa
caggacgcgggcaagctgatgcacgatcagcatccgacgatgtcctacgtcgatctcaac
cgctgcggcgtggcgctgatggaaatcgtcagccgcccggacatgcgcagcccggcggaa
gcgggcgcctatgtccgcaagctgcgcacgatcctgcgctatgtcgggtcgtgcgacggg
aacatggaagaaggatcgatgcgcgcggacgtgaacgtcagcgtgcgcaaaccgggcgag
gaattcggcacccgcaccgaaaccaagaacgtcaactcggtccgcttcgtcatgcagacg
atcgagcacgaggcgcgccgtcaggtcgatctgatcgaggatggcggcacggtggtgcag
gaaacgcggctgttcgatcccggcaccggcacgacccggtcgatgcgcagcaaggaagac
gcgcacgattaccggtatttccccgatcccgatctgctgccactggaactggagcaggcc
ttcctcgacgaatgccgcgccagcttgcccgagctgcccgatgccaagcgccgccgctat
gtcgaaacgctggggctgagcgaatataacgcgcgcgagctgacggccgaggtggaaacc
ttcgcccgcttcgaaacgcttctggccgcaaccgcgaagggtatcggcaagagcgagagc
gaggtcgcgacccaggtggccaactggtcgctttcggtcgcgccgggggttatcaacgcc
ctgggcgacgaagcgaacccggcgcacgccacggccgaagcgcaggcggcgatcctcgac
atgcaggcccgcggcgagatttcgggcggccaggcgaaggaaatcttcgaaatcgtcctc
aagaccggccgcgagccgggcgagatcgcggagagcgagggcctgaagcaggtcagcgat
accggcgcgatcgaggcggcgatcgacaaaatcctcgccaacaacaccgacaaggtggag
gaataccgcggcggcaaggacaagctcttcggcttcttcgtcggccagacgatgaaggcc
atgcagggcaaggccaacccggcggtggtcaaccagctgttgaaggcgaagctggggtag

DBGET integrated database retrieval system