KEGG   Schaalia meyeri: ADJ76_00545
Entry
ADJ76_00545       CDS       T04027                                 

Definition
(GenBank) pantothenate kinase
  KO
K00867  type I pantothenate kinase [EC:2.7.1.33]
Organism
amy  Schaalia meyeri
Pathway
amy00770  Pantothenate and CoA biosynthesis
amy01100  Metabolic pathways
amy01240  Biosynthesis of cofactors
Module
amy_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:amy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    ADJ76_00545
Enzymes [BR:amy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.33  pantothenate kinase
     ADJ76_00545
SSDB
Motif
Pfam: PRK AAA_18 CoaE
Other DBs
NCBI-ProteinID: AKU65835
LinkDB
Position
complement(115967..116950)
AA seq 327 aa
MPATASSAQSHSGTTRTSPSPYTRFDRAEWDRLADRTALPLTQEDINRIASLGDPIDMSE
VDAIYRPLSALLQLYIDGRRRTAAERHSFLGEPKACSTPFVIGIAGSVAVGKSTVARLLQ
LLLSRWDSTPRVDLVTTDGFLFPNRVLQERSLIARKGFPESYDRLALIWFLASVKAGVPH
AKAPVYSHVTYDVVPGAYVDVDRPDILIVEGLNVLQPPRLAPGSVSVAVSDYFDFSIYVD
ADEKHIEQWYVDRFLKLRATAFSREDSYFRTYASLTDAEAASTARMVWNAINLPNLRDNI
RPTRERATLVFTKGADHRVESLAIRKD
NT seq 984 nt   +upstreamnt  +downstreamnt
atcccagccacggcctcgtcggctcagtcccacagcggcaccacgcgcaccagtcccagc
ccctacacccgcttcgaccgagcggagtgggaccgcctggccgaccgcactgccctgccg
ctcacgcaggaggacatcaaccggatcgcatccctgggcgaccccatcgacatgagcgag
gtcgacgccatctaccgtcccctcagcgcgctcctgcagctttacatcgacgggcgcaga
cgcaccgccgccgagcgtcactccttcctgggcgagccaaaggcctgttccacgcccttc
gtcatcggcatcgccggatcggtcgcggtcggcaaatccaccgtcgcgcgcctgctccag
ctgcttttgtcccgctgggattccacgccgcgcgtcgacctggtgaccaccgacgggttc
cttttccccaaccgcgtcctgcaggaacgctccctcatcgcacgcaagggattccccgag
tcctacgaccgtctggccctcatctggttcctggcttccgtcaaggcgggagtcccccac
gccaaggcccctgtctactcgcacgtcacctacgacgtcgtgccgggcgcctacgtcgac
gtggatcggcccgacatcctcatcgtcgagggcctgaacgtcctgcagccgccgcgctta
gcccccggatccgtctccgtcgccgtctccgactactttgatttttccatctacgtcgac
gccgacgagaagcacatcgagcagtggtacgtcgaccgtttcctgaagctgcgcgccacc
gcattttcccgcgaggactcctacttcaggacttacgcatccctgaccgacgcggaggcc
gcatcgaccgcgcgcatggtgtggaacgcgatcaacctgccgaacctgcgcgataacatt
cggcccacccgcgagcgcgcgaccctggtctttaccaagggggccgaccaccgcgtcgaa
tccctggcgatccgcaaggactag

DBGET integrated database retrieval system