KEGG   Schaalia meyeri: ADJ76_00810Help
Entry
ADJ76_00810       CDS       T04027                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
amy  Schaalia meyeri
Pathway
amy00010  Glycolysis / Gluconeogenesis
amy00030  Pentose phosphate pathway
amy00051  Fructose and mannose metabolism
amy00052  Galactose metabolism
amy00680  Methane metabolism
amy01100  Metabolic pathways
amy01110  Biosynthesis of secondary metabolites
amy01120  Microbial metabolism in diverse environments
amy01130  Biosynthesis of antibiotics
amy01200  Carbon metabolism
amy01230  Biosynthesis of amino acids
amy03018  RNA degradation
Module
amy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:amy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ADJ76_00810
   00030 Pentose phosphate pathway
    ADJ76_00810
   00051 Fructose and mannose metabolism
    ADJ76_00810
   00052 Galactose metabolism
    ADJ76_00810
  09102 Energy metabolism
   00680 Methane metabolism
    ADJ76_00810
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    ADJ76_00810
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:amy01009]
    ADJ76_00810
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:amy03019]
    ADJ76_00810
Enzymes [BR:amy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ADJ76_00810
Protein phosphatases and associated proteins [BR:amy01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ADJ76_00810
Messenger RNA biogenesis [BR:amy03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     ADJ76_00810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK TetR_C_14
Motif
Other DBs
NCBI-ProteinID: AKU64504
UniProt: A0A1H1MEF2
LinkDB All DBs
Position
178892..181147
Genome map
AA seq 751 aa AA seqDB search
MSTVRIGVLTSGGDAQGMNAAVRGVVRTALARGAQPYAILEGWQGACDGGDSIKRMEWSD
VSSILAEGGTVIGTARSASFRTYEGRHRAAANLLEHGIDHLVVIGGDGSLSGTDEFRSEW
GQHVSELAAEGVISQEQALAHPDLIVVGLVGSIDNDMVGTDMTIGADTALHRILDAIDQL
TSTAASHQRTFVVEVMGRHCGYLPLMAAVAGGADYVFTPEDPAGPGWQDDLAEHLRLGRE
AGRRESIVLVAEGARDRDGNELSTQLIADTIKERTGEDARVTILGHVQRGGTPSAYDRWM
STLLGYAAVQEILQRTGEDEPIILGVRHNRITRIPLMKAVRDTRAVKDLIAAGDYAAAQA
SRGTSFSSMVGINQVLSTPPQLTPEPTGETKRVAVLHAGGLAPGMNTAARVAVRLGIARG
WTMLGVDGSWSGLADDRVRTLSWSDVEGWAFKGGAELGTKRDVPPVEQYYALGRAIERNS
IDALLVIGGLNAYLGVHAITSEKDRYPAFQIPMLLIPASIDNNLPGCELAIGTDTAINNA
TWAVDRIKESAAASKRCFIAETMGRRCGYLTLMSALSTGAEYMYMNEDSPALEQIAADAK
RMVSSFKSGRRLFLTLVNESASQYYDREFLADVFNAESEGIYDVRHMALGHLQQGGSPSP
YDRLLATRLVSHAFVQLVDQFERGDRGAYYIGQVGNATEARPVKNMFDDLDISNRRPFVQ
WWRDMVPVQRIVSLQNPGIEALPIHIDDPAE
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagtccgtatcggtgtcctcacgtcgggcggcgacgcccagggaatgaacgcg
gccgttcgcggcgtcgtacgcacggcgctggccaggggcgcacagccctacgcgatcctt
gaggggtggcagggcgcctgcgacggcggcgattccattaaaaggatggaatggtcggat
gtgtcctctatcctcgccgagggaggcacggtcatcggcacggcccgcagcgccagcttc
cgcacgtacgaggggcgccaccgcgcggccgcgaaccttctcgagcacgggatcgatcac
ctggtcgtgatcggtggcgacggctccttgtcgggcacagacgagttccgcagcgaatgg
ggccagcacgtgagcgagctggccgccgaaggcgttatctcgcaggagcaggctctcgcc
cacccggacctcatcgtcgttgggctggtggggtcgatcgataacgacatggtgggcacg
gacatgacgatcggcgcggacaccgcgctgcaccgcatcctggacgcgatcgatcagctg
accagcacggcggcctcgcatcagcggacgttcgtcgtcgaggtgatgggccgccactgc
ggctacctgccgctcatggcggccgtcgcgggcggcgctgactacgtgttcaccccggag
gacccggcgggcccgggctggcaggacgacctggcggagcacctgcgcctgggtcgcgag
gccgggcgacgcgaatcgattgtcctggtggctgagggggcgcgcgaccgcgacgggaac
gaactgtcgacccagctgatcgccgacacgatcaaggagcgcacgggtgaggacgcccgc
gtgaccatcctggggcacgtgcagcgcggcggcacaccatccgcctacgaccggtggatg
tcgaccctgctcggctacgcggctgtccaggaaatcctgcagcgcacgggcgaggacgag
cccatcatcctgggggtgcgccacaaccgtattacccgaatccccctcatgaaggcggtt
cgcgacacgcgcgccgtaaaggatctgatcgccgccggcgactacgcggctgcccaggct
tcgcggggcacgtccttctcgtcgatggtcggcatcaaccaggtgttgtccacgcccccg
cagctcactcccgagcccacgggagaaacgaagcgcgtcgcggtcctgcatgccggagga
ttggcacccggcatgaacacggcggcgcgcgtggctgtgcgcctcggtattgcgcgcggc
tggacaatgctgggtgttgacggatcgtggagcggcctcgcggatgatcgggtgcgtact
ctgagctggtcggacgtcgaaggctgggccttcaagggcggtgccgagctgggcacgaag
cgagacgtgcccccggttgagcagtactacgcgctgggtcgcgccattgagcgcaactcc
atcgacgcgcttctcgtgatcggcggcctgaacgcctacctgggtgtccacgcgatcacc
tcggaaaaggaccgctacccggcgttccagatccccatgctcttgatccctgcgtcgatc
gataacaacctgccgggctgcgagctcgcgatcggcacggacacggcgattaacaacgcg
acgtgggctgtcgaccgtatcaaggagagcgcggccgcgtccaagcgctgctttatcgcc
gagacgatgggccgacgctgcggctacttgaccctgatgagcgcgctgtcgacgggcgcg
gagtacatgtacatgaacgaggacagccccgccctcgagcagatcgccgcggacgccaag
cggatggtgagctctttcaagtcgggtcgtcgcctcttcctgacgctcgtcaacgagtcc
gcgtcccagtactatgaccgcgagttcctggccgacgtgtttaacgcggagtccgagggg
atctacgacgtgcgccacatggcgctgggccacctgcagcagggcggctcgccctcgccc
tacgatcgcctgctggccacccgcctggtgagccacgcgttcgtgcagctcgtggatcag
ttcgagcgcggggaccggggcgcctactacatcggacaggtcggcaacgccaccgaggcc
cgacccgtgaagaacatgttcgacgacctggatatctctaaccgtcgccccttcgtccag
tggtggcgcgacatggttcccgtccagcgcatcgtgtccctgcagaacccggggattgag
gcgttgccgatccacatcgacgatccggcggagtga

DBGET integrated database retrieval system