KEGG   Schaalia meyeri: ADJ76_03150Help
Entry
ADJ76_03150       CDS       T04027                                 

Definition
(GenBank) polyprenol monophosphomannose synthase
  KO
K00721  dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
amy  Schaalia meyeri
Pathway
amy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amy00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:amy01003]
    ADJ76_03150
Enzymes [BR:amy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     ADJ76_03150
Glycosyltransferases [BR:amy01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   ADJ76_03150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3
Motif
Other DBs
NCBI-ProteinID: AKU64891
LinkDB All DBs
Position
complement(713255..714040)
Genome map
AA seq 261 aa AA seqDB search
MTDSAHPAPSPIGDHTLIVIPTYNEMSTLPAVLNEVWMQVPNAHVLIVDDSSPDGTGEWV
DERCAGEARLHVLHRPAKSGLATAYVDGMGWGMEHAYPFLLQMDADGSHRPVDLPKLLTR
MSGPDHPDLVIGSRWVRGGRVNGWSAKRVALSKAGNYYVRFCLGTPVRDATAGLRVHRAS
FLVAHGVLGRVSTTGFGFQVEMTELERSLGAVIREVPITFDERIAGESKLDSSIFVEELA
MVTKGGLSRLAQAARAPFRSC
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgactgattccgcgcatcccgctccctcgccaattggcgatcacacactgatcgtgata
cccacttataacgaaatgtcgacgctaccagccgttctgaatgaagtgtggatgcaggtc
ccgaacgcccacgtactcatcgtcgatgactcgtccccggatggcacgggggagtgggtt
gacgaacgatgcgcgggggaggctcgacttcacgttctccaccgtccggcgaaatcaggc
ctggcaaccgcctacgtcgacggcatggggtggggcatggagcacgcctacccgttcctg
ctgcagatggatgcggacggttcgcatcgtccggtcgacttgcccaaattgttgacacga
atgtccggccccgatcatcctgacttggtgattggttcccggtgggtacgcggcgggagg
gtcaatggctggtcggctaaacgcgttgctctctcgaaggcgggcaattattatgtccga
ttttgcctcggaacgcccgttcgtgacgcgactgcgggcctgcgcgttcatcgtgcttcc
ttcctggtcgcacacggcgtcctggggcgcgtctcgactacgggattcggtttccaggtc
gagatgactgagctcgaacggtccttgggcgcggtaattcgcgaggtgcctatcactttc
gacgaacgcatcgccggcgaatcgaagctcgattcatcgatttttgtcgaggaactggca
atggtgacaaagggcggcctgagccgtctagcccaggccgcacgcgcgccgttccgttcg
tgttag

DBGET integrated database retrieval system