KEGG   Amycolatopsis sp. BJA-103: BKN51_09270Help
Entry
BKN51_09270       CDS       T05296                                 

Definition
(GenBank) hypothetical protein
Organism
amyb  Amycolatopsis sp. BJA-103
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Acyl_transf_1 KR Ketoacyl-synt_C PS-DH PP-binding KAsynt_C_assoc adh_short PKS_DE Thiolase_N Epimerase Polysacc_synt_2 GDP_Man_Dehyd ACP_syn_III NmrA
Motif
Other DBs
NCBI-ProteinID: AUI64327
LinkDB All DBs
Position
2197956..2208761
Genome map
AA seq 3601 aa AA seqDB search
MDVKARGAALLDEVTAGLELDEFVLFSSAASTLGAAGQGNYAAANAYLDALAEHRRARGL
PALAVAWGAWAGGGFADSSAAARTRTSRGGMRPMEPQLAVRALGEALRGVEPVQTVLDID
VAELPAELRTAPLLRDLPAIRRLPAVAAQPPATGELVRRLIGLSPADQDELLTDLVRTEA
AIVLGHASADAIEQRRAFKDLGFDSLTSVELRNRLGAATGERLPATVVFDYPTPEALAAF
LRTELLGEHPEIGVAAPAAVSSADEPMAIVGMACRFPGGSSTPEQFWEMLASGTDTVGDF
PADRGWDLDSVYDADRDNAGTSYVAQGAFVADAAGFDADFFGISPREALAMDPQQRLLLE
TSWEALERAGIDPAKLKGSATGVFAGGYISGYGLNLATESGVEAHSLTGNATSVLSGRIS
YVLGLEGPAVTIDTACSSSLVALHLAAQAVRSGECSLALAGGVTVMATPGMFIDFSRQQG
LSTDGRCRAFSDDADGTGWAEGAGVLVVERLSDAQRNGHPILAVVAGSAVNQDGASNGLT
APNGPSQQRVIRAALADAGLTVSDVDVVEAHGTGTTLGDPIEAQAVLATYGQDRDRPLWL
GSVKSNIGHTQAAAGVAGVIKMVLALRNKEIPRTLHTETPSSHVDWAAGDVRLLTENAPW
PVDGHPRRAGVSSFGMSGTNAHIILEDAPAAVPAEPEDATAPVVSGAGALVLSGRTEPGL
AAQARRLDDWLTGRETRPEDVAWSLATTRSVFERRAVVIGDGTGLTDLAAGSPSGAVVTG
SARTGVRPVFVFAGQGSQWLGMGRELAQVSPVFAARLAECEAALESFVDWKLSEVLAEEL
TTADLVQPALWAVMVSLAAVWEAAGVRPEAVVGHSQGEIAAATVAGMLSVEDGARVVALR
SKSLKALAGLGGMLSVSAAADAVEERLGRWDDRVSLAAVNGPAAVVVSGEPEALAELKSE
LDAEGVRARMVAVDYASHGVQVESLEAEIRAVLAEVSPRRGRVPMVSAMTGETLTGEELD
AGYWYQSLRAPVMFDRAIRTVAGSGNRMFVEVTPHPVLLGAMNDTLDELAADAESGTAPV
CGTLQRDDGGAVRLLTSFAEAFVHGVTVDWTKVLPVGNRVELPTYAFQHERFWPQGMLSL
SPHGGTDPAALGLSAVGHPLLGAAMELADGATVCSGRLSTRTQPWLADHAVGGVILFPGT
GFVELAVRAGDQVGRGKVEELTLQAPLVLPADGGAVRIQVVVAADRENLEIFSRPDGSAA
EWTRHATGVLAAASAPPAVSEDFGVWPPSDATALAVDGFYAAKLSDVYGPAFHGLRAAWR
RGEDVFAEIELPESVAGRADQFGLHPALLDAALHAALLEDSGDEVRMPFAWTGVELHAEG
ASVLRAKVGRSRRGDLSLVAVDPAGAPVVTVDSLTSRPVSAPAVAEPASSGLLFAEQWTP
AAEAAIPAGAWAVLGDDPFGLAEEPAVAGFPMQTYPDLAGLAAADPVPSIVLTSVAGAGS
MPEAAHTAAAAALGLVKDWLEEPRLDAARLVVVTRSGAAVAPGEAVADLAAAAVRGLLRS
AQAENPGRFVLVDLPTENAGIAALPAVLGGEEPELALRENGVFGRRVVRSSGNAMAVERP
DAGPGGPRSLLVTGGTGTLGGLVAQHLVRTGRAQEVLLTSRSGPAAAGAAARAAQLAELG
AAVRIVACDAADRDALAALLDTVGEDCPLGEVFHAAGIIDDGLVAGLTADRLSAVLRPKA
DAAWHLHELTRHLDLRQFVLFSSAAATFGAPGQGSYVAANTFLDALAGHRRAAGLTGTSL
AWGPWVHEAGIGRDLGEQSLSRISRSGVTALGADEGLAVMDAALATEDAVLIPVRLDVAA
LRGADVPPLWRALAGAPARRTAASAPAADSDSLRKRLAAATRQERDRMLRQLVLAHVAAV
LGHASAASIGADRAFTDLGFDSLTAVELRNRLRAETGLRLPATLIFDHPTPAALAVSLRG
ELIGDLSAPPPAPAVRRAGTDEPIAIVGMACRFPGGAASPEELWELLSSGGDAIESFPAD
RGWPVDELYDPESEQAGTTYTREGGFVRDVIGFDAGFFGISPREALAMDPQQRLLLEVSW
EAFERSGIDPASLSGSQTGAFIGGYGSGYAAAGLDGSAEFEGAESHLMTGNATSVLSGRL
SYFFGLEGPAVTMDTACSSSLVALHLAAKALSAGECSLALAGGATIMASPDGFVAFSQAR
GLAADGRSKAFAESADGMGMAEGVGMLVVERLSDARRNGHPVLGLVRGSAVNQDGASNGL
TAPNGPSQQRVIRAALASAGLSPSEVDAVEAHGTGTKLGDPIEAQALLATYGQDRDRPLW
LGSVKSNIGHTQAAAGVAGVMKMLLALGHEQLPKTLHAAEPSSQIDWTAGQVELLAEPMA
WPSGGRPRRAGISSFGISGTNAHIILEEAPPEDAEPRPDTEPLLRGPGAWLVSGRSAEGL
VGQAGRLREWAAAQPETDPADVAWSLATTRSAFAHRAVVLGEDRTKLLAGLHELATGGTT
GTVVAGTARPGGAVTFVFPGQGSQWAGMGRELAEASPVFAARLAECERALAPFADWNLTE
VLSGELRTADLVQPALWAVMVSLAAVWEAAGVAPDAVVGHSQGEIAAATVAGMLSLRDGA
RVVALRSKSLKVLAGAGGMLSVTLPAAAVEQRISRWGEQLALAAVNGPAAVVVSGTPEAL
AELKDELDAEGVRAKMVDVDYASHSAQVARLEDEIRAVLAGIEPRRGRVPMVSAMTGETL
TGEELDAGYWYASLRATVRFDRAVRTLADEGHQLFVEVSPHPVLLGATTDTLEEAAADAA
PGTEPAAVCATLRRDDGGATRMLTSLAQAYVTGAGVDWTAVLPVAERIALPTYAFRHDRY
WPTGAAAAGAVRGGDGSQAEAEFWAAVESGDLAQIADTLALEDQEQFSAVLPALASWRRR
DQEKSVTASWRYRMSWAPLPEPDSVLLNGTWLLVVPEGGFAETLRRDCAAALTVRGAEVV
VAEIPAGHAARHELSPVLDQAVDGAPIAGVLSLLALDEAPLPDHPVVAAGLAATLGLVQA
LGDAGVLAPLWLATSQAVAAATGEVPSSVVQAQVWGLGRVVGLEHPDRWGGLLDLPAEID
ERAGARLAAVLADGDEDQVALRRSGVLGRRMARAGRPRRGGSSWRPRGSVLITGGTGAIA
GHVSQWLAERDTERLVLTSRSGSSAAGIAAQAAGLAEQGSRVDVLTCDVGERAEVAGVLD
WIGRTGPELSSVMHTAGVLDDGVIDRLSTSRFEKVLSAKATSAGHLDELTAELDLDAFVL
FSSAASTLGSAGQGNYAAANAYLDAVAENRRARGLSGLSVAWGLWGGGGLAESKDAIKSR
MKRLPMPAMDPRLAVRALGESLDGSDAVVTVMDVDWSRLANLAQRPLVRDLPEMRQLAAA
PAAAAPEAGDLARRLAGLERADQERLLTDLVRAEAAVVLGHPSADAVRASQAFKELGFDS
LTAVEIRNRLNTATGLRVPTTLIFDYPTPVAVAAWLRSGLVGDDAAGVPVLDELDRLEAA
LTKPAAGQEMEDRITRRLQTILSAWITKQGGAEAEGGEVELGSATPDEVFEFLDKELGLS
D
NT seq 10806 nt NT seq  +upstreamnt  +downstreamnt
ctggacgtgaaagcccgcggcgcggcgttgctggacgaggtcaccgccggactggaactg
gacgagttcgtgctgttctcctcggccgcctcgaccctcggcgcggcgggacagggcaac
tacgcggccgcgaacgcgtacctggacgcgctggcggagcaccgtcgggcgcggggactg
cccgcgctggccgtggcgtggggcgcgtgggcgggcggcggcttcgccgactcaagcgcg
gccgcgcgcacccggaccagccgcggcggcatgcggccgatggagccgcagctcgcggtc
cgcgccctcggcgaggcgctgcgcggggtcgaaccggtgcagaccgtgctggacatcgac
gtggccgagctccctgcggagctgcggaccgcgccgttgctgcgggacctgccggcgatc
cgacgtcttcccgccgtcgccgcgcagccgcccgccaccggcgaactcgtgcggcggctg
atcgggctgagccccgccgaccaggacgaactgctcaccgacctggtccgcaccgaagcg
gcgatcgtgctcggccacgcctcggcggacgcgatcgagcagcggcgggcgttcaaggac
ctcgggttcgactcgctgacttccgtcgagctgcgcaaccggctgggggcggcgaccggc
gaacggctgcccgcgacggtggtgttcgactacccgaccccggaagcgctggccgcgttc
ctgcggaccgaactgctcggcgagcacccggaaatcggtgtcgccgcgcccgccgccgtg
tcgtctgccgacgagccgatggcgatcgtgggcatggcgtgccggttccccggcggttcc
agcactccggagcagttctgggagatgctggcctccggcactgacacggtgggggacttc
cccgccgaccgcggctgggacctcgacagcgtgtacgacgccgaccgggacaatgcgggt
acttcctatgtggcgcagggcgcgttcgtcgccgacgccgccgggttcgacgccgacttc
ttcgggatcagcccgcgcgaggcgctggcgatggacccgcagcagcggctgctgctggag
acctcgtgggaggcgctggagcgggccgggatcgacccggcgaagctcaagggcagcgcc
accggcgtcttcgcgggcggctacatctccggctacggcctcaacctggccaccgaaagc
ggggtcgaagcgcacagcctgaccggcaacgccaccagcgtgctgtccggccggatctcc
tacgtcctcggcttggaaggccccgcggtcaccatcgacaccgcgtgctcgtcgtcgctg
gtcgccctgcacctggccgcgcaagcggtgcgctccggcgaatgctcgctggcgctggcc
ggtggcgtcacggtgatggcgaccccgggcatgttcatcgacttctcgcgccagcagggc
ctttccaccgacgggcggtgccgggcgttctccgacgacgcggacggcaccggctgggcc
gaaggcgcgggcgttctggtggtggagcggctttccgacgcacagcgcaacggacacccg
attctggctgtagtggccggttccgcggtgaaccaggacggtgcgtcgaacgggttgacg
gcgccgaacggtccttcgcagcagcgagtgattcgggcggcgttggccgatgccgggctg
acggtgtccgatgtggacgtcgtggaggcgcacggcacgggcacgacgctgggcgacccg
atcgaggcgcaggccgtgctcgcgacgtacggccaggaccgggatcgtccactgtggctg
ggttcggtcaagtccaacatcggccacacccaagcggcggccggtgtggccggggtgatc
aagatggtgttggcgttgcggaacaaagagattccgcgcacgctgcacaccgagacgcct
tcgtcgcatgtggactgggcggcgggcgacgttcgcctgctgaccgagaacgcgccgtgg
ccggtcgacggtcatccgcgccgcgcgggcgtgtcgtcgttcgggatgagcggcaccaac
gcacacatcatcctggaggacgcgccggccgcggtgccggccgaaccggaggacgcgacg
gctccggtggtgtccggcgcgggtgcgctggtgctgtccggccggaccgagccgggactc
gccgcacaggcgcgtcgcctggacgactggctgaccgggcgggagacgcgtccggaggac
gtggcctggtcgttggcgacgacgcggtcggtgttcgaacgccgggccgtggtgatcggc
gacggcaccggtttgacggatctggcggcgggttcgccctcgggtgcggtggtgaccggg
tcggcgcggaccggggtccggccggtgttcgtgttcgccgggcagggttcgcagtggctc
ggcatgggccgggaactcgcgcaggtgagtccggtgttcgcggcgcggttggcggagtgt
gaggcggctttggagtcctttgtggactggaagctgtctgaggtgttggccgaagagctg
acgacggcggatctggtgcagcctgcgttgtgggcggtgatggtgtctctggccgcggtg
tgggaggcggctggggtgcgtccggaggcggtggtcggtcattcgcagggcgagatcgcg
gcggcgactgttgcggggatgttgtccgttgaggacggtgcgcgggttgttgcgctgcgc
tccaagtctttgaaggcgttggcgggtctaggcggcatgctgtcggtcagcgcggcggcc
gatgcggtggaggagcggctcggccggtgggatgatcgagtgtcgctcgcggccgtgaac
ggtccggccgcggtggtcgtttcgggtgagccggaggcgttggccgaactgaagtccgag
ttggatgccgagggtgtccgggcacggatggtggcggtggattacgcgtcgcatggtgtg
caggtggagagcctggaagcggagatccgcgcggtgctggcggaggtgtcgccgcggcgg
ggccgggtgccgatggtgtcggcgatgacgggggagaccctgaccggcgaggaactggac
gccggttactggtaccagagcctgcgtgcgccggtgatgttcgaccgcgcgatccggacg
gtggcgggcagcgggaaccggatgttcgtcgaggtgaccccgcacccggtcctgctcggc
gcgatgaacgacaccttggacgaactggccgccgacgcagagtcgggaaccgccccggtc
tgcggcacgttgcagcgcgacgacggcggcgcggtccggctgctcacctcgttcgccgag
gctttcgtgcacggcgtgaccgtcgactggacgaaggtgctgcccgtcgggaaccgggtc
gagctgcctacctacgccttccagcacgagaggttttggccgcagggcatgctttcgctc
tcgccccacggcggcacggacccggccgcgctggggttgtccgcggtcgggcacccgctg
ctcggcgcggcgatggaactcgccgacggcgcgacggtgtgctccggccggctctccaca
cgtactcagccgtggctggccgaccacgccgtcggcggcgtgatcctgttccccggcacc
ggattcgtggagctggcggtgcgcgcgggcgaccaggtgggccgcggcaaggtggaagaa
ctgaccttgcaggccccgctggtgctgcccgccgacggcggtgcggtgcggatccaggtc
gtcgtcgccgcggaccgcgagaacctggagatcttctcccgcccggacggttccgcggcg
gagtggacccgccatgccaccggcgtgctggcggccgcgtccgccccgcccgcggtgtcg
gaggacttcggcgtctggccgccttcggacgcgaccgcgttggccgtcgacggcttttac
gccgcgaaactgtccgatgtgtacggtccggcgttccacggcctgcgcgcggcatggcgg
cgcggcgaggacgtgttcgccgagatcgagctgccggagtcggtggcgggccgagcggat
cagttcggcctgcacccggcgttgctcgacgccgccctgcacgccgcgctgctggaggac
tccggcgacgaggtccggatgccgttcgcatggaccggcgtcgaactccacgccgagggc
gcttcggtgctgcgcgccaaagtcgggcgcagtcggcgcggcgatctttcgctggtcgcc
gtcgaccccgccggtgctccggtggtcacggtggattcgttgaccagtcgtccggtgtcc
gcgcccgcggtcgccgaaccggcttcgtccggtctgttgttcgccgaacagtggaccccg
gccgccgaggccgcgatcccggccggtgcctgggcggtgctcggcgacgaccccttcggc
ctggcagaagagccggccgtcgcgggcttcccgatgcagacctacccggacctcgccgga
ctggcggccgcggaccccgttccctcgatcgtgctcaccagcgtcgccggggccggctcg
atgcccgaagccgcgcacaccgccgccgcggcggcgctcggactggtcaaggactggctg
gaggaaccgcgcctggacgcggcgcggctggtggtggtcacccggtccggcgccgcggtc
gccccgggcgaggccgtggccgatctcgccgcggccgccgtccgtgggctgctgcgttcg
gcacaggcggagaaccccggccggttcgtcctcgtggatctgcccaccgaaaacgccgga
atcgccgcgctccccgccgtgctcggcggggaggaaccggagctggcgttgcgggagaac
ggcgtcttcggacgccgcgtggtccgttcgtctggcaacgcgatggcggttgaacgaccc
gacgcgggccccggcggcccccgttcgctgctggtcaccggcggcaccggcaccctcggc
ggcctggtcgcccagcatctggtgcgcaccggccgcgcccaggaagtgctgctgaccagc
cggtccggcccggccgccgccggagcggccgcgcgcgccgcgcagctggcggaactgggc
gccgcggtccggatcgtcgcgtgcgacgcggccgaccgcgacgcgctggccgcgctgctg
gacaccgtcggagaggactgcccgctcggcgaggtcttccacgccgccgggatcatcgac
gacggcctggtcgccgggctcaccgccgaccgcctgtccgcggtcctgcgcccgaaggcc
gacgccgcctggcacctgcacgaactcacccggcacctggacctgcggcagttcgtgctg
ttctcctcggccgcggcgaccttcggcgcgccgggacagggcagctacgtcgccgccaac
accttcctcgacgcgctcgccggacaccgccgggcagcgggcctgaccggcacttcgctg
gcctggggcccgtgggtgcacgaggcgggcatcggccgcgacctcggcgaacagtcgttg
tcgcggatcagccgctccggcgtcaccgcgctcggcgccgacgagggtctcgcggtgatg
gacgcggcgctggccaccgaagacgccgtgctcatcccggtccgcctggacgtggcggcc
ctgcgcggtgccgacgtcccgccgctgtggcgggcgctggccggtgctcccgcgcggcgc
accgctgcttcggccccggctgctgacagcgactcccttcgcaagcggctggccgcggcc
actcgccaggaacgcgaccggatgctgcggcagctggtgctggcgcacgtggccgcggtg
ctcgggcacgcctcggcggcttcgatcggcgccgaccgcgcgttcaccgatctgggcttc
gactcgctgaccgcggtggaactgcggaaccggctgcgggccgaaaccgggctgcggctg
cccgccacgctgatcttcgaccaccccacgcctgccgcgctggccgtttcgctgcgcggc
gagctgatcggcgacctgtccgcgccgcccccggccccggccgtgcggcgggccggaacg
gacgagccgatcgcgatcgtcggcatggcctgccggttccccggcggcgccgccagcccg
gaggagctgtgggagctgctgtcctccggcggcgacgcgatcgaatccttcccggccgac
cgaggctggccggtggacgagctctacgacccggagtccgagcaggccgggaccacctac
accagggaaggcggtttcgtccgcgacgtcatcggtttcgacgccggtttcttcgggatc
agcccgcgcgaggcgctggcgatggacccgcagcagcggttgctgctggaggtgtcctgg
gaggcgttcgaacgctccggcatcgacccggcgagcctgtcgggcagccagaccggcgcc
ttcatcggcggctacggctcgggttacgcggcggcgggtctggacggcagcgcggagttc
gagggtgccgaaagccacctgatgaccggcaacgcgaccagcgtcctttcgggccgcctg
tcgtacttcttcgggctggaaggcccggcggtcacgatggacaccgcgtgttcctcgtcg
ctggtcgcgctgcatctggcggcgaaggcgctgagcgcgggggagtgctccctcgcgctg
gccggcggagccacgatcatggccagcccggacgggttcgtcgccttctcgcaggcacgc
ggtctggcggcggacggccggtcgaaggcgttcgccgagtcggccgacggcatgggcatg
gccgagggtgtcggcatgctggtggtggagcggctctccgacgcgcggcgcaacgggcat
ccggtgctggggctggtccggggttccgcggtgaaccaagacggggcctcgaacggcttg
acggcgccgaacggtccgtcgcagcagcgggtcatccgcgcggcgctggcaagcgccggc
ctttcgccgtccgaagtggacgcggtggaggcacacggcaccggcacgaaactcggcgac
ccgatcgaagcgcaggcgttgctggccacctacggccaagaccgggaccgcccgttgtgg
ctgggttcggtgaagtcgaacatcggccacacacaggcggcggccggcgtggcgggcgtg
atgaagatgctgctggcgctgggacacgagcagctgccgaaaaccctgcacgcggccgag
ccgtcctcgcagatcgactggacggccgggcaggtcgaactgctcgccgaaccgatggcc
tggccttccggcggacggccgcgccgggccgggatttcctcgttcggcatcagcggcacc
aacgcgcacatcatcctcgaggaggccccgccggaggacgccgaaccgcgtccggacacc
gagcccctgctgcgcggacccggtgcctggctggtgtccggccgctccgcggagggcctc
gtcggacaggctggccggctgcgcgaatgggcggccgcgcagccggagaccgaccccgcc
gacgtggcgtggtcgctggcgacaacccgctcggcgttcgcgcaccgtgccgtcgtcctc
ggcgaggaccggacgaaactgctggccggactgcacgagctggcgaccggaggcaccacc
ggcacggtggtggccggaacggcccgccccggcggcgcggtgacgttcgtcttccctggc
cagggctcccagtgggcgggcatgggccgggaactggcggaggccagcccggtcttcgcg
gcccggctcgccgaatgcgagcgggcactggcgccgttcgccgactggaacttgacggag
gtgctctccggcgaactgcgcaccgcggacctggtgcagcccgcgctgtgggcggtgatg
gtctcgctggccgcggtgtgggaagcggccggagtagcgccggatgcggtggtggggcac
tcgcagggcgagatcgcggccgccaccgtcgccgggatgctgtccctgcgggacggcgcg
cgggttgtcgcgctgcgctcgaagtcgctgaaagtgcttgcgggcgcgggcgggatgctg
tcggtgacgctgcccgccgcggcggttgaacagcggatctcccgctggggagagcagctc
gcgctggccgcggtcaacggcccggccgccgtggtcgtctccggcactcccgaagcgctc
gcggagctcaaggacgaactcgacgccgagggcgtgcgcgccaagatggtcgacgtcgat
tacgcctcgcactccgcgcaggtggcgcggctggaagacgagatccgtgcggtgctggcc
gggatcgagccgcgtcgtggccgggtcccgatggtgtcggcgatgaccggcgaaaccctg
accggcgaagaactcgacgccgggtattggtacgcgagcctccgcgccaccgtgcgtttc
gaccgtgcggtgcggacgctggccgacgagggacaccagctgttcgtcgaggtcagcccg
catccggtgctgctcggcgcgacgaccgacacgctggaggaagccgccgcggacgccgcc
cccggcacggaaccggccgcggtgtgcgcgacgctgcgccgcgacgacggcggcgcgacc
aggatgctcacctcgttggcgcaggcgtatgtcacgggagccggggtggactggaccgcg
gtgctcccggtcgccgagcggatcgccttgcccacctacgccttccggcacgaccgctac
tggccgaccggggcggctgccgccggcgcggtgcgcggcggcgatggttcgcaggccgaa
gccgaattctgggcggcggtggagagcggcgacctggcccagatcgccgacaccctggcg
ctggaggaccaggagcagttcagcgcggtgctgcccgcgctggcgtcctggcggcgtcgg
gaccaggagaagtcggtgaccgcgagctggcgctaccgcatgtcgtgggcgcccctgccg
gaacccgattccgtgctgctgaacggaacttggctgctcgtcgtccccgaaggcggcttc
gccgagacgctgcggagggactgcgccgcagcgctgaccgtacggggcgccgaggtcgtg
gtcgcggagatccccgccgggcacgccgcccggcacgagctttcgccggtgctcgaccag
gccgtcgacggcgcgccgatcgccggggtgctctcgctgctggcgctcgacgaagctccg
ctgccggaccatccggtggtggccgccggactcgccgccacgctgggcctggtgcaggcg
ttgggcgacgccggggtgctcgcgccgctgtggctggcgaccagccaggcggtcgcggcc
gcgaccggcgaggtgccctcgagcgtcgtgcaggcgcaggtgtgggggctgggccgggtc
gtcggactcgaacacccggaccgctggggcgggctgctcgacctgcccgccgagatcgac
gagcgggcgggcgcgcggctggccgcggtgctggccgacggcgacgaggaccaggtcgcc
ctccgccggtccggggtgctgggccgccggatggcgcgggcaggacgcccgcggcgaggc
gggtcctcgtggcggccgcgcggcagcgtgctgatcaccggcggcaccggcgcgatcgcc
gggcacgtctcgcagtggctggccgaacgcgacaccgagcggctcgtgctcaccagccgg
tccggctcctcggccgcgggcatcgcggcgcaggcggcggggctggccgaacagggcagc
cgggtggacgtgctgacctgcgacgtcggcgagcgggccgaggtcgccggggtgctcgac
tggatcgggcgcaccggacccgagctgtcctcggtgatgcacaccgccggcgtactcgac
gacggcgtgatcgaccggctctccacctcgcgcttcgagaaggtcctctcggccaaggcc
accagtgcgggccacctggacgagctgaccgccgagctggacctggatgcgttcgtgctg
ttctcctcagcggcttcgacgctgggctcggccgggcagggcaactacgcggcggcgaac
gcctacctggacgcggtggcggagaaccggcgcgcgcggggcctcagcggtctgtcggtg
gcgtggggcctgtggggcggcggcggtctcgccgagtccaaggacgcgatcaagagccgg
atgaagcggctgccgatgcccgcgatggatccgcgcctggcggtgcgggcgctgggcgaa
tcgctcgacgggtccgatgccgtggtgacggtgatggacgtggactggagccggctggcc
aacctggcgcagcgcccgctggtgcgggacctgcccgagatgcggcagctggccgcggct
ccggccgcggccgcgccggaagcgggcgacctcgcccggcggctggcggggctcgaacgg
gccgaccaggaacggctgctcaccgatctggtgcgcgcggaggccgcggtggtgctcggc
cacccgtcggcggacgcggtgcgggcgagccaggcgttcaaggaactcggcttcgattcg
ctgaccgcggtggagatccggaacaggttgaacaccgccaccgggctgcgggtcccgact
acgttgattttcgactaccccaccccggtggcggtggccgcctggctgcggtccgggctc
gtcggcgacgacgcggccggggtcccggtgctggacgagctggaccggctggaggcggcg
ctgacgaaaccggcggccgggcaggagatggaggaccggatcacgcgtcggctgcagacg
atcctgtcagcgtggatcacgaagcagggcggagcggaagccgagggcggcgaggtcgaa
ctcggctcggcgacgcccgacgaggtgttcgagtttctcgacaaggaactgggcctgtcc
gactag

DBGET integrated database retrieval system