KEGG   Amycolatopsis sp. BJA-103: BKN51_13170Help
Entry
BKN51_13170       CDS       T05296                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
amyb  Amycolatopsis sp. BJA-103
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AUI59064
UniProt: A0A2N8MTL2
LinkDB All DBs
Position
complement(3105690..3107141)
Genome map
AA seq 483 aa AA seqDB search
MIANDKLFIGGEWTTPSDPTPLDIVSPHDQSLLGRVVQALPADIDRAVAAARTAFDEGPW
PRTPPEERIAVLRRLNALREARAAEIAELISAENGSALWFTRAGQPGVGRLAVSYLKAAE
EFGWEETLTPSDPSAPFRSIVRREPIGVVSAIIPWNSPFSASMAKIVPALLAGNTVVLKV
SPENSLSMSLLADLLAEAGLPSGVISVLPADRETSEYLVKHPGVDKIAFTGSTAAGRRIA
SLAGAQLKRVSLELGGKSAAVILPGAVLEDAIAGLRFGSLLNNGEACIAQTRILAPRSRY
DEVVDGLKEMMESLVVGDPADEKTFIGPMVRPGQQQRVRDYIEIGAAEGARLVTGGPEIP
DGLEKGNYVTPTLFADVDSAMRIAQEEIFGPVLVVLPYDDEDDAIRIANDSEYGLSGGVW
SADEEHALAVARRMRTGTVTVNGAPIGFDGPFGGFKASGVGREYGAAGLAQYVELKTVTV
PNS
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgcgaacgacaagctcttcatcggaggcgaatggacgacgccgagcgatccgacg
ccgctggacatcgtgtcccctcacgaccagtccttgctggggcgcgtcgtccaggccctt
cccgccgacatcgaccgtgccgtcgccgcggccaggaccgctttcgacgaaggaccgtgg
ccgcggaccccgccggaggaacggatcgcggttcttcggcggctcaacgccttgagggag
gcccgcgcggccgagatcgccgagctgatctcggccgagaacggctcggccctgtggttc
acgcgggccggtcagcccggagtgggacggctggccgtctcgtacctgaaggcggccgag
gagttcggctgggaggagacgctcacgccctcggacccgtccgcgccgttccgttcgatc
gtgcgccgggaaccgatcggcgtggtgtccgcgatcatcccgtggaactcaccgttctcg
gcgtcgatggccaagatcgtcccggcgctgctcgcggggaacacggtcgtcctcaaggtc
tcgccggagaactcgctcagcatgagcctgctcgcggacctgctggcggaggccgggctg
ccgtccggggtgatcagcgtgctgcctgcggaccgcgagaccagcgagtacctggtgaaa
caccccggagtcgacaagatcgcgttcaccggctcgaccgccgcggggcgccggatcgcg
tcgctggcgggtgcgcaactcaagcgggtcagcctggaactaggcggcaaatccgcggcc
gtgatcctgcctggcgccgtgctggaggacgcgatcgccgggctgaggttcgggtcgctg
ctcaacaacggcgaggcgtgcatcgcgcagacgcggatcctcgcgccccgtagccggtac
gacgaggtcgtcgacggactcaaggagatgatggagtctctcgtcgtcggcgacccggcc
gacgagaagaccttcatcggcccgatggtgcggcccggtcagcagcaacgggtgcgcgac
tacatcgagatcggcgccgccgagggcgcgcggctggtcaccggaggtcccgagatcccg
gacggcctcgagaagggcaactacgtcacgccgacgttgttcgccgacgtcgacagcgcg
atgcggatcgcccaggaggagatcttcgggccggtgctcgtcgtcctgccttacgacgac
gaggacgacgcgatccgcatcgcgaacgattccgagtacgggctctccggcggtgtctgg
tcggccgacgaagagcacgcgctcgcggtcgcccggcggatgcgcaccgggacggtcacc
gtcaacggggcgccgatcggcttcgacggcccgttcggcgggttcaaggccagcggcgtc
ggccgtgaatacggtgccgccggtcttgcccagtacgtggagctcaagaccgtcaccgtg
ccgaactcgtga

DBGET integrated database retrieval system