KEGG   Amycolatopsis sp. BJA-103: BKN51_19005Help
Entry
BKN51_19005       CDS       T05296                                 

Definition
(GenBank) peptidase
  KO
K01286  D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
amyb  Amycolatopsis sp. BJA-103
Brite
KEGG Orthology (KO) [BR:amyb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BKN51_19005
Enzymes [BR:amyb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BKN51_19005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: AUI64530
UniProt: A0A2N8MK92
LinkDB All DBs
Position
complement(4493620..4494753)
Genome map
AA seq 377 aa AA seqDB search
MKLPVVTAVAVVAAVLTSVPAAATPCLGKPDPAALSAAIAGLPDKDTTGALVRVTGLSGA
WSGTSGESDVRTHAPVRPDGFFRIGSTTKVYTAVMVLQLAQENRIDLEQPVQRYLPGVLP
AGYPPVPVRTLLDHTSGLPSVDIPGLYEPEWILAHRYDHWSPREVVDTALRHPIDFQPGT
AQKYTNTAYVTAGMLVEKVTGQSYARNLRDRITVPLGLWETFYPEDDPRLPNPAARGYLD
VDGELVDVTEMNQSIPGAAGAIVSTAGDLDKFITGLFGGRLLGPSVMPRLFAVPDVPMAD
GNGRASYSQGLMKLTLNGLTVWGKTGSRYGYASGIFATQDLSRVVAYSVNPTVKSPDGQP
LIVQKIAEAASRSLPKT
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttccagttgtcacagcagtcgccgtcgtcgcggcggtcctcacctcggtgccg
gccgccgcgacaccctgcctcggaaagcccgaccccgccgcgttgtcggcggcgatcgcg
ggtctgcccgacaaggacacgacgggcgcgctggtccgggtcaccggcctgtccggcgcg
tggtccggcacctccggggagtccgacgtccgcacccatgcccccgtccggccggacggg
ttcttccggatcggcagcaccaccaaggtctacaccgccgtcatggtgctccagttggcg
caggagaaccggatcgacctcgaacagccggttcagcggtatctccccggggtgcttccg
gcgggctatccgccggtgccggtgcgcaccctgctcgaccacacctccgggttgccgtcg
gtggacatccccggtctctacgagccggagtggatcctcgcacatcgctacgatcactgg
agcccgcgcgaggtggtggacaccgcgctgcgccatccgatcgacttccagcccggtacg
gcccagaagtacacgaacaccgcttacgtcacggcgggaatgctcgtcgagaaggtgacg
ggacagtcctacgcccgcaatctgcgcgatcgcatcaccgtgccgctcggcctttgggag
accttttacccggaggacgacccgcgtctgccgaacccggccgcgcgcggttatctcgac
gtggacggggaactggtcgacgtcaccgagatgaaccagtccatccccggcgccgccggc
gcgatcgtctccacggccggggacctcgacaagttcatcaccggtctgttcggtggccgg
ctgctcggtccctcggtgatgccgcgcctgttcgccgtgccggacgtgcccatggccgac
ggcaacggccgggcgagttacagccagggcttgatgaagctgaccctgaacgggctcacc
gtctggggaaagaccggcagccggtacggctacgcgagtgggatcttcgccacccaggac
ctttccagggtggtggcgtactcggtcaatcccacggtgaaatccccggacggccagccg
ctcatcgtgcagaagatcgcggaagcggcgagcaggagcctgccgaagacctag

DBGET integrated database retrieval system