KEGG   Amycolatopsis sp. BJA-103: BKN51_20220Help
Entry
BKN51_20220       CDS       T05296                                 

Definition
(GenBank) amino acid oxidase
Organism
amyb  Amycolatopsis sp. BJA-103
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 Thi4 FAD_binding_2 Pyr_redox FAD_oxidored HI0933_like FAD_binding_3 Lycopene_cycl Pyr_redox_3 AlaDh_PNT_C GIDA NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AUI60287
UniProt: A0A2N8MQC6
LinkDB All DBs
Position
complement(4745797..4747092)
Genome map
AA seq 431 aa AA seqDB search
MGSPEVDVVIVGAGFAGLTAARDLGSAGRTVRVLEARDRIGGRTWYRTDLFDGVGLEMGG
TWIVPEQTFVTEEVRRYGIAVSDSELPARMTWSDRGTVLKSLLPVPPGELEDLELAVRAL
VAAGARLDVDRPLSGQGLADLDVPIRQWADEAGLKGNARELLISWFCGCGNASADTGSAL
DILRWIAAMGNSVWGMVRASVLGRTFDDGTVSLATALAEDGGADIRLSTPVRWVRQEADH
VVVGHDGGEVTARRVLVTVPIGVQRHIEFTPALSPAKLAISTENHAGQGQKVWALARNVP
DDLSGYGWGTEFDYVGAMYTVPEGVVLVCFAPEHDRVDGHDVADVQRAVREFAPEAEVVA
ATTYEWVDDEWSRGTWTTFRAGQISRYERDLAVPEGLVHFAGAHTAQRWPGFIDGAIDSG
RRAAAELLAML
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgggttctccggaagtcgatgtcgtgatcgtgggcgcgggcttcgccgggctgacggcc
gcacgtgatctcggctcggccgggcgaacggtgcgcgtgctggaggcgcgcgaccggatc
ggcggccgtacctggtaccggaccgacctgttcgacggagtcgggctggagatgggcggt
acgtggatcgtccccgagcagaccttcgtcaccgaggaggtccgccggtacgggatcgcg
gtcagcgacagcgagttgccagcccggatgacctggtcggatcgcggcaccgtgctgaag
tcgctgcttccggtgccgcccggcgaactggaggacctggaactcgcggtgcgcgccctg
gtggcggccggcgcccggctcgacgtggaccgcccgctctccggacagggcctggccgac
ctcgatgtgccgatccggcagtgggccgacgaagccggcttgaagggcaacgcgcgggaa
ctgctgatctcctggttctgcggctgcggcaacgcttccgccgacaccggctccgcgctg
gacatcctgcgctggatcgccgccatgggcaactccgtctggggcatggtccgggcgagc
gtgctcgggcggaccttcgacgacggcaccgtctcgctcgccacggcgctggcggaggac
ggcggcgcggacatccggctgagcacgcccgtgcggtgggtgcgccaggaggcggaccac
gtcgtcgtcggacacgacggcggagaggtcacggcgcggcgggtgctggtcaccgttccc
atcggcgtgcagcggcacatcgagttcacgcccgcgctgtccccggcgaagctggccatc
tccaccgagaaccacgccgggcaggggcagaaggtgtgggcgctggcccgcaacgtgccg
gacgacctgagcggatacggctggggtaccgagttcgactacgtgggcgcgatgtacacc
gtgcccgagggcgtggtgctggtgtgcttcgcgcccgagcacgaccgggtggacgggcac
gacgtggcggacgtgcagcgggcggtgcgcgagttcgcgcccgaggccgaggtcgtcgcc
gcgaccacgtacgagtgggtggacgacgagtggtcgcgcggcacctggacgaccttccgg
gccgggcagatctcccgttacgaaagggatctcgccgtgccggagggcttggtgcacttc
gccggggcccacaccgcccagcggtggccgggtttcatcgacggtgcgatcgacagcggt
cgccgcgccgccgccgaactgctggcgatgctgtga

DBGET integrated database retrieval system