KEGG   Amycolatopsis sp. BJA-103: BKN51_26825Help
Entry
BKN51_26825       CDS       T05296                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
amyb  Amycolatopsis sp. BJA-103
Pathway
amyb00250  Alanine, aspartate and glutamate metabolism
amyb00410  beta-Alanine metabolism
amyb00640  Propanoate metabolism
amyb00650  Butanoate metabolism
amyb01100  Metabolic pathways
amyb01120  Microbial metabolism in diverse environments
Module
amyb_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:amyb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BKN51_26825
   00650 Butanoate metabolism
    BKN51_26825
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BKN51_26825
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BKN51_26825
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:amyb01007]
    BKN51_26825
Enzymes [BR:amyb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BKN51_26825
Amino acid related enzymes [BR:amyb01007]
 Aminotransferase (transaminase)
  Class III
   BKN51_26825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AUI61431
UniProt: A0A2N8N1X4
LinkDB All DBs
Position
6194636..6195886
Genome map
AA seq 416 aa AA seqDB search
MAQLSPLLKQATPVVVDHGEGVYLYDTDGKRHLDFTAGIGVTSTGHCHPHVVSAAREQIG
KLIHGQYTTVMHKPMLELTEKLGGVLPEGLNSLFYSNSGSEAVEAALRLSRQATKRPNVI
VFQGGFHGRTVAAATMTTSGTRFSAGISPLMSGVHVAPFPYAFHYGWDEETATKFALREL
DYLFATVCAPNETAAFFIEPVLGEGGYVPANPEFLAGLRERADRHGILLVMDEIQTGFGR
TGKFWGHDHFGVSPDIVLIAKGLASGFPISGIAASEELMAKALPGSQGGTYGGNAVACAA
AVATLEVIEREGLVENAAERGRQLLEGVRVIADKSPSIGDVRGLGLLVGSEFTTPDGEPD
TAKAQAAQKAASANGLLLLTCGAYMNVVRMVPPLVVDTEQVDEALRIWGDVVAGVE
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggcccagctatcaccgctgctcaagcaggcaacgccggtcgtggtcgaccacggtgaa
ggggtgtacctctacgacaccgatggcaaacgtcacctggacttcaccgccggtatcggc
gtgaccagcaccggccactgtcacccgcacgtggtgagcgccgcgcgggagcagatcggc
aaactcatccacgggcagtacacgacggtcatgcacaagccgatgctggaactgaccgag
aagctgggcggcgtcctcccggaaggactgaattccctcttctactcgaactcgggcagc
gaggcggtcgaagcggcgctccggctgtcgaggcaggcgaccaagcggcccaacgtcatc
gtcttccagggcggcttccacggtcggaccgtcgcggcggcgaccatgacgacgtcgggg
acccggttcagcgccgggatctcgccgctcatgtccggtgtgcacgtcgcacccttcccc
tacgcgttccactacggctgggacgaggagaccgcgacgaagttcgccctccgcgagctc
gactacctgttcgcgacggtctgcgcgccgaacgagacggccgcgttcttcatcgagccg
gtgctcggcgaaggcggctacgtcccggcgaaccccgagttcctggccgggctgcgggag
cgcgccgacaggcacgggatcctgctggtgatggacgagatccagaccggcttcggccgg
acgggcaagttctgggggcacgaccacttcggggtgagcccggacatcgtgctcatcgcg
aagggactcgccagcgggttcccgatctcgggcatcgccgcgtcggaagagttgatggcg
aaggcgctccccggttcgcagggcgggacttacggcggaaacgcggtggcctgtgcggcg
gcggtggccacgctcgaagtgatcgagcgggagggcctggtcgagaacgccgccgaacgc
ggacgccagctgctcgaaggcgtgcgggtgatcgcggacaagtcgccgtcgatcggcgac
gtccgcgggctggggctgctggtcggttccgagttcaccacgccggacggcgagccggac
accgcgaaggcacaggcggcccagaaagccgcttccgccaacgggttgctgttgttgacc
tgtggggcgtacatgaacgtcgtccggatggttccgccgctggtcgtcgacaccgaacag
gtcgacgaagcgctgcggatctggggtgacgtcgtggcgggggtcgagtga

DBGET integrated database retrieval system