KEGG   Amycolatopsis sp. BJA-103: BKN51_30165Help
Entry
BKN51_30165       CDS       T05296                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
amyb  Amycolatopsis sp. BJA-103
Pathway
amyb00500  Starch and sucrose metabolism
amyb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amyb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BKN51_30165
Enzymes [BR:amyb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     BKN51_30165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AUI62017
UniProt: A0A2N8N088
LinkDB All DBs
Position
complement(6909050..6911239)
Genome map
AA seq 729 aa AA seqDB search
MRKLVLPALAGVLIAGLVPAVAEAQGSETQGGEAPGAPGAHPSWLPADKTGFGTARDRAS
NVWFTLQGGRMSEVYYPDLSTPSVRSLDLVVTDGKSFATVDSSARSQQVRRTGADGLTYE
QTITDDQRRWKVRKTYVTDPARTSVLIDVDFVSLTGRPYQVYAVADPDLTNEGSDDSARS
GVANAVASDAKTAAALAAEPAFSRTSVGYAGSSDGVTQLTKSFALKDYASAAKGNVLLTG
QTSADGVRSRDFTLSLGMGAKDSEALSNAKASLRRGFADAARAYDRGWKQYLRQVKDVPS
SLKTKKERDLYKASVLMLAASEDKIHQGALIASPSMPWRFGNNDPEWSPSGTYHLVWPRD
LYQIATGLLAAGDRDAANRSVDYMFGTQQLPDGHMPQNSHVDGTPYWTSIQLDETALPIV
LAQQLGRTDAKTWQGVRKAAEFLVSYKADNGHASPYSQQERWEEQDGYSPSTIAAVIAGL
VCAADLAKANGAAADAKRYLDTADAFKAKLARWTVTTNGPLSKDPYFVRLTKDGNADNGT
KYNLGNSSVTMDQRAVTDAGFLELVRLGIYRADDPVIRNSIKVTDADIAFTTPTGQFWHR
YTKDGYGEKADGSPWDYTFPAESRTTFGRLWPLLAGERGEYDLAAGDRGTAAKRLRDLGR
VSSSGDTMPEQVWDENAPSGQTGFPAGTPTASATPLAWTHAQYLRLAWSVEAGKVIEQPR
VVRCHFLGC
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaactcgtgctcccggcactggcaggcgtactgatcgcgggcctggtcccagcg
gtcgccgaggcccagggcagtgaaacacagggcggtgaggcgcccggagcgcccggcgcc
catccgagctggctcccggcggacaagaccggcttcggcaccgcccgtgatcgggcgagc
aacgtctggttcaccctccagggcggccggatgtccgaggtctactacccggatctgtcc
acgccgagcgtccgctcgctggacctcgtcgtcaccgacgggaagagcttcgccaccgtc
gattcttcggccaggtcgcagcaggtgcggcgcaccggcgcggacggcctcacctacgag
cagaccatcaccgacgaccagcgccgctggaaggtgcgcaagacctacgtcaccgacccg
gctcgcacgagtgtgctgatcgacgtcgacttcgtctcgctgaccggccgcccgtaccag
gtgtacgcggtcgcggaccccgatctcaccaacgaaggctccgacgactccgcgcgatcc
ggcgtggcgaacgcggtcgcttccgacgcgaagaccgcggccgcgctggccgcggaaccg
gcgttctcgcgcacttccgtggggtacgcgggttcctccgacggcgtcacccagctgacg
aagtccttcgcgctcaaggattacgccagcgcggcgaagggcaacgtgctgctcaccggg
cagacgtccgccgatggtgtccgctcgcgggacttcacgctctcgctcggcatgggcgcg
aaggactccgaggcactctccaacgcgaaagcctcgctacggcgcggattcgccgacgcc
gcccgcgcgtacgaccgcggctggaagcagtacctccgccaggtgaaggacgtcccgtcg
tccctcaagaccaagaaggaacgggacctctacaaggcgtccgtgctgatgctcgcggcg
agcgaggacaagatccaccagggggcgctcatcgcgtcgccgagcatgccgtggcgattc
gggaacaacgacccggagtggtcgccgtcgggcacctatcacctggtctggccccgtgac
ctctaccagatcgcgaccggcctgctcgccgccggtgatcgcgacgccgccaaccggtcg
gtcgactacatgttcggcacacagcagttgccggacgggcacatgccgcagaacagccac
gtcgacggcactccgtactggacgtccatccagctcgacgagaccgcgctgccgatcgtg
ctcgcgcagcaactcggccgcaccgacgccaagacctggcagggcgtgcgcaaggcggcg
gaattcctggtgtcctacaaggcggacaacgggcacgcctcgccgtacagccagcaggag
cgctgggaggagcaggacggctactcgccttcgacgatcgccgcggtgatcgccggactg
gtctgcgcggcggatctcgccaaggcgaacggcgccgccgccgacgcgaagcgctacctc
gacaccgccgacgcgttcaaggcgaaactcgcccggtggacggtgaccacgaacggcccg
ctgtcgaaggacccgtacttcgtccggctgaccaaggacggcaacgcggacaacggcacg
aagtacaacctcggcaactccagcgtcacgatggaccagcgtgccgtgaccgacgcgggt
ttcctcgaactggtgaggctgggcatctaccgggccgacgatccggtgatccggaacagc
atcaaggtcaccgacgccgacatcgcgttcaccaccccgacgggtcagttctggcaccgg
tacacgaaggacggctacggcgagaaggccgatggctcaccctgggactacacgttcccg
gccgaaagccggaccacgttcggacggctctggccactgctcgcgggtgaacgcggcgag
tacgacctcgccgccggtgaccggggtacggccgcgaagcgccttcgcgacctggggcgc
gtcagcagctccggggacaccatgccggagcaggtctgggacgagaacgcgccttcgggg
cagacgggcttcccggcgggcacgccgacggcgtccgcgaccccgttggcgtggacgcac
gcccagtacctccggctcgcctggtcggtggaggccgggaaggtgatcgagcagccgcgc
gtggtgcggtgccacttcctgggctgctga

DBGET integrated database retrieval system