KEGG   Amycolatopsis sp. BJA-103: BKN51_31500Help
Entry
BKN51_31500       CDS       T05296                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
amyb  Amycolatopsis sp. BJA-103
Pathway
amyb00250  Alanine, aspartate and glutamate metabolism
amyb00410  beta-Alanine metabolism
amyb00430  Taurine and hypotaurine metabolism
amyb00650  Butanoate metabolism
amyb01100  Metabolic pathways
amyb01110  Biosynthesis of secondary metabolites
amyb01120  Microbial metabolism in diverse environments
amyb02024  Quorum sensing
Module
amyb_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:amyb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BKN51_31500
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BKN51_31500
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BKN51_31500
   00430 Taurine and hypotaurine metabolism
    BKN51_31500
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BKN51_31500
Enzymes [BR:amyb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BKN51_31500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AUI64831
UniProt: A0A2N8MZL5
LinkDB All DBs
Position
complement(7185596..7186969)
Genome map
AA seq 457 aa AA seqDB search
MVLHKGKATDPDREGGTNPLYAGAYPALAASIRLPHDSLAEDPLPPDTALQLVRDELMLD
GNARLNLATFVTTWMEPQARELMAECVDKNMIDKDEYPQTAELERRCVNILADLWHAPDQ
NAIMGCSTTGSSEACMLAGMALKRRWSKLGRTGKPNLVMGANVQICWEKFCEYWEVEPRL
VPMEGDRFHLTADEAIARCDENTIGVVAILGSTFDGSYEPVAEIVAALDGLQERSGWDIP
VHVDGASGAMIAPFLDPELVWDFRLPRVASINTSGHKYGLVYPGVGWVVWRDKAALPEEL
VFNVNYLGGDMPTFALNFSRPGAEVAAQYYTFVRLGREGFRAVQQASRDVATQLADGIAG
LGPFELLTRGDQLPVFAFTTKADVEGFDVFDVSRRLRERGWLVPAYTFPENRTDLAVLRI
VVRNGFTHDLADLLLADLRRLLPELDHGPRRRTAFHH
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgcacaaggggaaagcgaccgacccggaccgcgagggcgggaccaacccgctg
tacgccggcgcgtaccccgcgctcgccgcgagcatccgcctcccgcacgacagcctcgcc
gaagatccgctgccgcccgacaccgcgcttcagctggtgcgcgacgagttgatgctcgac
ggcaacgcccggctcaacctcgccacgttcgtcaccacgtggatggagccgcaggcccgc
gagctgatggccgaatgcgtcgacaagaacatgatcgacaaggacgagtacccgcagacg
gcggagctcgagcggcgttgcgtgaacatcctcgcagacctgtggcacgcgcccgatcag
aacgcgatcatgggctgctccacgaccggttcctcggaagcctgcatgctcgccgggatg
gcgctgaagcgccgctggtcgaagctcgggcgcaccggcaagccgaacctggtgatgggc
gcgaacgtccagatctgctgggagaagttctgcgagtactgggaggtcgagccgcggctg
gtgccgatggaaggcgaccgcttccacctcaccgccgacgaggcgatcgcccggtgcgac
gagaacaccatcggcgtcgtcgcgatcctcgggtccactttcgacggcagttacgagccc
gtcgcggagatcgtggccgcgctcgacgggctccaggaacgttccggctgggacattccg
gtgcacgtcgacggcgcttcgggcgcgatgatcgcgccgttcctcgatccggagctggtc
tgggacttccggttgccgagggtggcgtcgatcaacacctccgggcacaagtacgggctg
gtctatcccggcgtcggctgggtggtgtggcgggacaaggcggcgttgccggaagagctc
gtcttcaacgtcaactacctcggtggcgacatgccgactttcgcgctgaacttctcgcgc
cccggcgccgaggtggccgcgcagtactacacgttcgtccggctcggacgcgaaggtttc
cgtgctgtgcaacaggcttcgcgtgacgtggcgacccagctggccgacgggatcgccgga
ttggggcccttcgagctgctcacccgcggcgatcagttgcccgtgttcgccttcacgacg
aaggcggacgtcgagggcttcgacgtcttcgacgtgtcacggcgccttcgcgagcgtggc
tggcttgtcccggcgtacacgttcccggagaacaggaccgatctcgcggtgctgaggatc
gtggtgcgcaacggtttcacccacgacctcgcggatctgctgctcgccgacctccggcgc
ctgctgcccgagctcgaccacggtccgcgacggcggacggcgttccatcactga

DBGET integrated database retrieval system