KEGG   Amycolatopsis sp. BJA-103: BKN51_35005Help
Entry
BKN51_35005       CDS       T05296                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
amyb  Amycolatopsis sp. BJA-103
Pathway
amyb00250  Alanine, aspartate and glutamate metabolism
amyb00410  beta-Alanine metabolism
amyb00640  Propanoate metabolism
amyb00650  Butanoate metabolism
amyb01100  Metabolic pathways
amyb01120  Microbial metabolism in diverse environments
Module
amyb_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:amyb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BKN51_35005
   00650 Butanoate metabolism
    BKN51_35005
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BKN51_35005
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BKN51_35005
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:amyb01007]
    BKN51_35005
Enzymes [BR:amyb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BKN51_35005
Amino acid related enzymes [BR:amyb01007]
 Aminotransferase (transaminase)
  Class III
   BKN51_35005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AUI62851
UniProt: A0A2N8MW58
LinkDB All DBs
Position
complement(7910124..7911407)
Genome map
AA seq 427 aa AA seqDB search
MTDADLLARHKAVLPSWLALYYDEPIEIVHAQDRRVIDSTGRSYLDFFAGILTNSMGYDV
SAISDAVRKQLDTGILHTSTLYLIRSQVELAERIAKLSGIPDAKVFFTNSGTEANDTALM
LATQYRRSNQVLAMRNSYHGRSFATVGITGNRGWSASSLSPVKVSYVHGGYQYRSPFRAL
SDTEYIDACVADLVDVLETGTSGDVACMIAEPIQGVGGFSSPPDGLFKAMKEVLDQYGIL
FISDEVQTGWGRTGEHYWGIQAHDVVPDAMTFAKGLGNGLAIGGLVARGDLVDCLTANSI
STFGGNPVAMAGAAAVLDHIADHDLQANALARGNELLSGLRASGHPLIGDVRGKGLMIGV
ELVKPGGMEPDTQAAARMMEETKARGLLIGKGGLHGNVLRIAPPMTLTADEAAEGLGIIV
DALAAIS
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatgcggacctgctggcgcggcacaaggcggtactgccgtcctggctggcgctc
tactacgacgagccgatcgagatcgtgcacgcgcaggaccgccgggtcatcgactcgacc
gggcggagctacctcgacttcttcgcgggcatcctgacgaactcgatgggctacgacgtc
tcggcgatcagcgacgccgtgcgcaagcaactcgacacggggatcctgcacacctcgacg
ctgtacctgatccgctcgcaggtcgaactggccgagcgcatcgcgaagctctccggcatc
cccgacgcgaaggtgttcttcaccaactccgggaccgaggccaacgacaccgcgctgatg
ctcgccacccagtaccggcgcagcaaccaggtgctggcgatgcggaactcgtaccacggg
cggtcgttcgcgacggtcggcatcacgggcaaccgcggctggtcggcgtcgtcgctcagc
ccggtgaaggtgagctacgtccacggcggctaccagtaccgcagcccgttccgggcgctt
tcggacaccgagtacatcgacgcgtgcgtcgcggacctagtcgacgtgctggagacgggc
acctcgggcgacgtcgcctgcatgatcgccgagccgatccagggcgtcggcgggttcagc
tcaccgccggacggcctgttcaaggcgatgaaggaggtcctcgaccagtacgggatcctg
ttcatctccgacgaggtccagaccggctggggacggaccggggaacactactgggggatc
caggcgcacgacgtcgtccccgacgcgatgaccttcgcgaagggcctcggcaacggtctc
gcgatcggcggtctcgtggcccgcggcgacctcgtcgactgcctgaccgcgaactcgatc
tcgaccttcggcggcaacccggtcgcgatggcgggcgcggcggcggtcctcgaccacatc
gccgaccacgacctccaggccaacgcactcgcccggggcaacgagctgctgtccggcctg
cgcgcttcggggcatccgctgatcggggacgtccgtggcaagggcctgatgatcggcgtc
gaactggtcaaaccaggcggcatggagccggacacccaggccgcggcgcggatgatggag
gagaccaaggcgcgcgggctgctgatcggcaagggcgggctgcacggcaacgtgctgcgg
atcgcgccgccgatgacgctcaccgccgacgaggccgcggagggcctggggatcatcgtg
gacgcactagccgccatctcctga

DBGET integrated database retrieval system