KEGG   Amycolatopsis sp. BJA-103: BKN51_36100Help
Entry
BKN51_36100       CDS       T05296                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K14949  serine/threonine-protein kinase PknG [EC:2.7.11.1]
Organism
amyb  Amycolatopsis sp. BJA-103
Brite
KEGG Orthology (KO) [BR:amyb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:amyb01001]
    BKN51_36100
Enzymes [BR:amyb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BKN51_36100
Protein kinases [BR:amyb01001]
 Serine/threonine kinases: Other
  Bacterial family
   BKN51_36100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PknG_TPR PknG_rubred Pkinase Pkinase_Tyr TPR_19 DZR RIO1 ANAPC3 TPR_16
Motif
Other DBs
NCBI-ProteinID: AUI63039
UniProt: A0A2N8MWN3
LinkDB All DBs
Position
8143489..8146161
Genome map
AA seq 890 aa AA seqDB search
MSEEPRRPRHAAPDDTKPDQEAESASWTPPAPVRWETPEPSISGRLDSSEPPKRKAAPET
DAERTIFHAPVQQRPQTPPRGQQRPIPGAEDPTRPPGEMAPVSPQTQVVRPAWQAPADAP
QPTSVLSSPTPETQSIMPPAPRVDPGPGQLPDPGTESVLPERSSESHGTGTGTGTGSGSR
GTGTGTGSFPGTARRTSSRTSRRGRLGAGLVDVPQVPYRDPASAVLDNPMVSEEKRFCGN
CSAKVGRGKDGRPGSPEGNCEKCGNPFSFVPKLRPNEIVGGQYEVLGALAYGGLGWIYLA
QDHNVSDRWVVLKGLIDTGDATAMAAAANEQRFLAEVEHPNIVKIHNFVQHPDGDTGNSV
GYIVMEYVGGQSLRQLALAHHRETKRPEPLPIGQVIAYGLEILPAMGYLHSQNLLYCDLK
PDNVIQTHEQLKLIDLGAVRRIDDYESPLFFTTGYSAPELATHGASVASDLYTVGRTLAV
LSFEFSGYTSKYKATLPGPDVVPLFALFGSYYRFLRRATHTDPDRRFIAAEEMGDQLTGV
LREIMALGTGKPRPGASTVFGPETRTFGVDLVVPEHGGSVPLPDPGEVVSGLPIPQVDTD
DPAAGMLASTVALDPAGAIDSLAGAPRESIEVRLRIVRARIELGELVEAQRQLQAGQYLA
IKAGFPHDWRIDWYRGLIELAGGRSRVAHVAFEAVYDDLPGEIAPKLALAVSAEGVGDYF
GAARYYELVWRTDRSYVSAAFGLARVYLAQGARASAIEVLEAVPASSTHYVAAQVAAIKI
KTRINGGGKDPVQVSERDLVDASTRLERLQLDAERRTRLSAEVLEAAHGWLNSQNRPTPG
AKVLGCALDERDLRFGLERCYRTLARLAGTVDQRVELVDKANAIRPRTLT
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggaagagccgcgccgtcctcggcacgcagcgccggacgacaccaagccggaccaa
gaggccgagtccgcgtcctggacgccgccggcaccggtccgctgggagacgcctgaaccg
tcgatttccggcaggctcgattcctccgagccgccgaagcggaaagccgcgcctgagacg
gacgccgagcgcacgatcttccacgcgccggtccagcagcgtccgcagaccccgccgcgc
ggccagcagcggccgatccccggcgccgaggacccgacgcgcccgccgggggagatggcc
ccggtgagcccgcagacccaggtcgtccgacccgcgtggcaggcgcccgcggacgcgccg
cagccgaccagcgtgctctcgtcgcccaccccggagacgcagagcatcatgccgccggcg
ccgcgcgtcgaccccggccccgggcagctgccggacccgggcacggaaagcgtcctcccc
gaacggtccagcgaaagccacggaaccgggaccggcacggggaccggatcgggcagccgg
gggaccggcaccggcacggggtcgttccccggcaccgcacgccggacgtcgtcgcgcacg
tctcgccgcggccgtctgggcgcgggactcgtcgacgtcccgcaggtgccgtaccgcgac
ccggcatccgccgtcctcgacaacccgatggtgtcggaggagaagcgcttctgcggcaac
tgcagcgccaaggtcggccgaggcaaggacggccggcccggttcgcccgagggcaactgc
gagaagtgcgggaacccgttctccttcgtcccgaagctgcgcccgaacgagatcgtcggc
ggccagtacgaggtgctcggcgcgctcgcgtacggcgggctcggctggatttacctcgcg
caggaccacaacgtcagcgaccgctgggtggtgctcaagggcctgatcgacaccggtgac
gccaccgcgatggccgccgccgccaacgagcagcggttcctcgccgaggtcgagcacccg
aacatcgtcaagatccacaacttcgtgcagcatccggacggcgacaccggcaactcggtc
ggctacatcgtcatggagtacgtcggaggccagtcgctgcgccagctcgccctcgcgcac
caccgcgagacgaagcgcccggagccgctgccgatcggccaggtgatcgcctacgggctc
gagatcctgcccgccatgggctacctgcacagccagaacctgctgtactgcgacctcaag
cccgacaacgtgatccagacgcacgaacagctcaagctgatcgacctcggcgcggtccgc
cgcatcgacgactacgagagcccgctgttcttcaccaccggctacagcgctcccgaactg
gcgacccacggcgcttcggtggcatcggatctgtacacggtcggccgcacgctcgccgtc
ctcagcttcgaattctccgggtacaccagcaagtacaaggcgaccctgcccggcccggac
gtcgtcccgctgttcgcgctcttcggttcgtactaccgcttcctgaggcgcgcgacgcac
accgacccggaccgccggttcatcgcggccgaggagatgggcgaccagctgaccggcgtg
ctccgcgagatcatggcgctgggcaccgggaagccgcgccccggcgcgtcgaccgtcttc
ggcccggagacccgcacgttcggcgtcgacctggtcgtccccgagcacggcgggagcgtg
ccgctgccggatcccggcgaagtggtctcgggcctgccgatcccgcaggtcgacacggac
gacccggcggcgggcatgctcgcgtcgaccgtcgcgctcgatcccgcgggcgcgatcgac
tcactggccggggcgccgcgcgagtcgatcgaggtccggttgcgcatcgtccgcgcccgc
atcgagctcggtgagctggtcgaggcgcagcggcagttgcaggccgggcagtacctcgcg
atcaaggccgggttcccgcacgactggcggatcgactggtaccgcggcctgatcgagctc
gcgggcggccgctcccgcgtcgcgcacgtcgcgttcgaggcggtgtacgacgaccttccc
ggcgagatcgcgccgaagctggccttggccgtcagcgcggagggcgtcggggactacttc
ggcgccgcgcgctactacgagctggtgtggcgaacggaccggtcgtacgtcagcgcggcc
ttcgggctcgctcgcgtttatctcgcgcagggcgcccgcgccagcgcgatcgaggtgctg
gaggccgttccggcgtcgtccacgcactacgtcgccgcgcaggtggccgcgatcaagatc
aagaccaggatcaacggcggcggcaaggacccggtgcaggtgtccgagcgggatctcgtc
gacgcctcgacgaggctcgagcgtttgcagctcgacgccgaacgccgcacgcggttgtcg
gcggaggttctcgaggcggcgcacggctggctcaactcgcagaaccggccgacgccgggt
gcgaaagtgctgggctgtgccctggacgagcgagacctgcggttcgggctcgagcgctgt
tatcggaccctcgcccgcctggccgggaccgtcgaccagcgcgtcgaactcgtcgacaag
gccaacgcgatccgccccaggacgctcacctag

DBGET integrated database retrieval system