KEGG   Amycolatopsis sp. BJA-103: BKN51_38290Help
Entry
BKN51_38290       CDS       T05296                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
amyb  Amycolatopsis sp. BJA-103
Pathway
amyb00020  Citrate cycle (TCA cycle)
amyb00480  Glutathione metabolism
amyb01100  Metabolic pathways
amyb01110  Biosynthesis of secondary metabolites
amyb01120  Microbial metabolism in diverse environments
amyb01130  Biosynthesis of antibiotics
amyb01200  Carbon metabolism
amyb01210  2-Oxocarboxylic acid metabolism
amyb01230  Biosynthesis of amino acids
Module
amyb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amyb_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:amyb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BKN51_38290
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BKN51_38290
Enzymes [BR:amyb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BKN51_38290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AUI63428
UniProt: A0A2N8MXS8
LinkDB All DBs
Position
8579157..8580380
Genome map
AA seq 407 aa AA seqDB search
MAKIKVQGTVVELDGDEMTRIIWQFIKDRLIHPYLDVDLEYYDLGIEERDRTDDQVTIDS
ANAIKKHGVGVKCATITPDEARVEEFGLKKMWLSPNGTIRNILGGVIFREPIVIQNIPRL
VPGWTKPIIIGRHAHGDQYKATNFKVPGPGTLTISYTPDDGSEPMEFEVAKFPEGGGVAM
GMYNYRKSIEDFARASLQYGLDREYPVYMSTKNTILKAYDGMFKDVFEEIYQAEFKADFD
AKGISYEHRLIDDMVAAAMKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLRTPDG
RTVEAEAAHGTVTRHYRQHQQGKPTSTNPIASIYAWTRGLEHRGKLDSNQELIGFANKLE
KVVVETVESGKMTKDLALLISKDQAFQTTEEFLATLDDNLAKKIAQG
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggccaagatcaaggtccagggcaccgtcgtcgagctcgacggcgatgagatgacccgc
atcatttggcagttcatcaaggacaggctgatccacccgtacctggacgtggacctggag
tactacgacctgggcatcgaggagcgggaccgcaccgacgaccaggtcaccatcgattcg
gccaacgcgatcaagaagcacggcgtcggcgtcaagtgcgccacgatcacgccggatgag
gcgcgagtcgaagagttcggcctgaagaagatgtggctctcgccgaacggcacgatccgc
aacatcctcggcggcgtgatcttccgcgagccgatcgtcatccagaacatcccgcgcctg
gtgccgggctggaccaagccgatcatcatcggccgtcacgcgcacggcgaccagtacaag
gcgaccaacttcaaggtccccggtcccggcacgctgaccatcagctacaccccggacgac
ggctccgagccgatggagttcgaggtcgcgaagttccccgagggcggcggcgtcgccatg
gggatgtacaactaccgcaagtccatcgaggacttcgcgcgcgcctcgctgcagtacggc
ctcgaccgtgagtacccggtctacatgtcgaccaagaacaccatcctgaaggcctacgac
ggcatgttcaaggacgtgttcgaggagatctaccaggccgagttcaaggccgacttcgac
gccaagggcatctcctacgagcaccgcctgatcgacgacatggtcgccgcggcgatgaag
tgggaaggcggctacgtctgggcctgcaagaactacgacggtgacgtccagtccgacacg
gtcgcgcagggcttcggctcgctgggcctgatgacgtcggtgctgcgcaccccggacggc
cggaccgtcgaggccgaggccgcgcacggcacggtgacccggcactaccgccagcaccag
cagggcaagccgacctcgaccaacccgatcgcgtccatctacgcgtggacccggggcctc
gagcaccgcggcaagctggactcgaaccaggagctgatcgggttcgcgaacaagctggag
aaggtcgtcgtcgagaccgtcgagagcggcaagatgaccaaggacctcgcgctgctgatc
agcaaggaccaggcgttccagaccaccgaggagttcctcgcgacgctggacgacaacctg
gccaagaagatcgcccagggctga

DBGET integrated database retrieval system