KEGG   Amycolatopsis sp. AA4: CU254_02725Help
Entry
CU254_02725       CDS       T05278                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
amyc  Amycolatopsis sp. AA4
Pathway
amyc00020  Citrate cycle (TCA cycle)
amyc00480  Glutathione metabolism
amyc01100  Metabolic pathways
amyc01110  Biosynthesis of secondary metabolites
amyc01120  Microbial metabolism in diverse environments
amyc01130  Biosynthesis of antibiotics
amyc01200  Carbon metabolism
amyc01210  2-Oxocarboxylic acid metabolism
amyc01230  Biosynthesis of amino acids
Module
amyc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amyc_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:amyc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CU254_02725
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CU254_02725
Enzymes [BR:amyc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CU254_02725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP
Motif
Other DBs
NCBI-ProteinID: ATY09507
UniProt: A0A2K8LM46
LinkDB All DBs
Position
543126..544349
Genome map
AA seq 407 aa AA seqDB search
MAKIKVQGTVVELDGDEMTRIIWQFIKDKLIHPYLDVNLDYYDLGIEERDRTDDQITIDA
ANAIKQHGVGVKCATITPDEARVEEFGLKKMWVSPNGTIRNILGGVIFREPIVMRNVPRL
VPGWTKPIIIGRHAHGDQYKATNFKVPGPGTLTMTYTPEDGSEPMEFQVANFPEGGGVAM
GMFNFRKSIEDFARASLQYGLDREYPVYLSTKNTILKAYDGMFKDVFQEIFETEFKADFD
AKGITYEHRLIDDMVAASLKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLRTPDG
KTVEAEAAHGTVTRHYRQHQQGKPTSTNPIASIYAWTRGLEHRGKLDGNSELIGFANKLE
QVVVDTVEGGKMTKDLALLVGKDQEWQTTEEFLATLDENLAKKIAQG
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggccaagatcaaggtccagggcaccgttgtcgaactcgacggcgacgagatgacccgc
atcatctggcagttcatcaaggacaagctgatccacccgtacctggacgtcaacctggac
tactacgacctgggcatcgaggagcgggaccgcaccgacgaccagatcacgatcgacgcc
gccaacgccatcaagcagcacggcgtcggcgtcaagtgcgccacgatcacgcccgacgag
gcgcgcgtggaggagttcggcctcaagaagatgtgggtgtccccgaacggcaccatccgc
aacatcctcggcggcgtgatcttccgcgagccgatcgtcatgcggaacgtgccccggctg
gtacccggctggaccaagccgatcatcatcggccggcacgcgcacggcgaccagtacaag
gccaccaacttcaaggttcccggcccgggcaccctgaccatgacctacacccccgaagac
ggctccgagccgatggagttccaggtcgcgaacttccccgagggcggcggcgtcgcgatg
gggatgttcaacttccgcaagtcgatcgaggacttcgcgcgcgcgtcgctgcagtacggc
ctcgaccgcgagtacccggtctacctgtcgaccaagaacaccatcctcaaggcctacgac
ggcatgttcaaggacgtgttccaggagatcttcgagaccgagttcaaggccgacttcgac
gccaagggcatcacctacgagcaccggctgatcgacgacatggtcgccgcgtcgctcaag
tgggagggcggctacgtctgggcgtgcaagaactacgacggcgacgtccagtccgacacc
gtcgcgcagggcttcggttcgctcggcctgatgacctcggtgctgcgcacgccggacggc
aagaccgtcgaggccgaggccgcgcacggcacggtcacccggcactaccgccagcaccag
cagggcaagccgacctccacgaacccgatcgcctcgatctacgcgtggacccgcggcctc
gagcaccgcggcaagctggacggcaactccgagctgatcggcttcgcgaacaagctggag
caggtcgtggtcgacaccgtcgagggcggcaagatgaccaaggacctcgcgctgctggtc
ggcaaggaccaggaatggcagacgaccgaggagttcctcgcgacgctggacgagaacctg
gccaagaagatcgcgcagggctga

DBGET integrated database retrieval system