KEGG   Amycolatopsis sp. AA4: CU254_02895Help
Entry
CU254_02895       CDS       T05278                                 

Definition
(GenBank) alcohol dehydrogenase
Organism
amyc  Amycolatopsis sp. AA4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 3HCDH_N FAD_binding_3 TrkA_N ApbA NAD_binding_2 Pyr_redox_2 AlaDh_PNT_C NAD_binding_7 Pyr_redox Shikimate_DH NAD_binding_8 adh_short UDPG_MGDP_dh_N XdhC_C THF_DHG_CYH_C ThiF NADH_4Fe-4S F420_oxidored Sacchrp_dh_NADP ADH_N_assoc
Motif
Other DBs
NCBI-ProteinID: ATY09537
UniProt: A0A2K8LM75
LinkDB All DBs
Position
578021..579028
Genome map
AA seq 335 aa AA seqDB search
MRAAIVDRPGEIRVGEVPDPKPGERQVVVKVGACGICGTDLHIADGHFPPTPYPIVPGHE
FSGEIVELGADVPAEWKVGDRVAVDPSIYCGYCTPCRSGHGNLCANWNATGDTVNGAFAE
YVAVPADTCYRIPDAMTWEQGALVEPVSCAVHGVRRIGVEAGERFLVVGAGTMGLIMQQL
LLRAGAHVTMVDRNADRLPRATDLGAAAVASDVSELDDERFDAAVDCTGAAPAIEAAFNA
LHRGGRLLVFGVAPAEARVALSPFRIYNDEITIVGSMAVLNSYGNALDLVANGYIDTEAL
ITDTLPLEQYPEALAKMRSGSGLKIQVLPGGGGRA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccgcgatcgtggaccggcccggggagatccgggtcggcgaggttcccgatccg
aagcccggggagcgccaggtcgtcgtgaaggtgggtgcctgcgggatctgcggcacggac
ctgcacatcgccgacgggcatttccccccgaccccgtatcccatcgtccccgggcacgag
ttctccggggagatcgtcgaactgggcgcggacgtgcccgccgaatggaaggtcggcgac
cgggtcgcggtcgacccgtcgatctactgcggatactgcacgccgtgccggtccgggcac
ggcaacctctgcgcgaactggaacgcgaccggcgacacggtcaacggcgcgttcgccgag
tacgtggcggtgcccgcggacacctgctaccggatacccgacgcgatgacctgggaacaa
ggcgcgctggtcgaacccgtttcctgcgcggtgcacggcgtgcgccggatcggcgtggag
gcgggcgaacgcttcctcgtggtcggcgcgggcacgatgggcctgatcatgcagcagctc
ctgctccgggcgggcgcgcacgtgacgatggtcgaccgcaacgccgaccggctgcctcgc
gcgactgacctcggcgcggccgcggtggcttccgatgtgtccgaattggacgatgaacgc
ttcgacgcagccgtggactgcaccggtgcggcacccgccatcgaggccgccttcaacgcg
ctgcaccgcggtggccggttgctcgtgttcggcgtcgctccggccgaagcacgcgtcgcg
ctttcgccgttccgcatctacaacgacgagatcaccatcgtcggttcgatggcggtgctg
aacagctacggcaacgcgctcgacctggtcgcgaacggctacatcgacaccgaagcgctg
atcaccgacaccctgccgctcgagcagtaccccgaggcactggcgaaaatgcgcagcggg
tccggcctcaagatccaggtgctgcccggaggtggcggccgtgcgtaa

DBGET integrated database retrieval system