KEGG   Amycolatopsis sp. AA4: CU254_05890Help
Entry
CU254_05890       CDS       T05278                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
amyc  Amycolatopsis sp. AA4
Pathway
amyc00440  Phosphonate and phosphinate metabolism
amyc01100  Metabolic pathways
amyc01120  Microbial metabolism in diverse environments
amyc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:amyc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    CU254_05890
Enzymes [BR:amyc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     CU254_05890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ATY10044
UniProt: A0A2K8LNN6
LinkDB All DBs
Position
complement(1201633..1202697)
Genome map
AA seq 354 aa AA seqDB search
MPPTLPARKAPPPRGRVPDHCEMNARLTGRRSSNVPGNSCERGSSSAASGFTPQPPGEVL
FDNIHAIAADRKWRPIKDTEHILTAAGAHNGLSARLVDEAGFDFVWASGLEISASLGLAD
ADIVGRTESAQAVSAILRATSLPVIVDCDAGYGNAVNAWHTAQHYFAAGVYGLCLEDKTF
PKMNSFVEHSHALIPAATMAGKVEAMLDCKVVEQQQVIARTEALIAGASVDEALERGLAY
AEAGADAVLVHDKTKHAEKLLEFAERWTSPTPLVCVPTTYYEFTTKELGEAGFSLAIYAN
QGIRSQIAAVKRVLTQIRANGSSRDVEDEIAPVKEVFALQRLDEVSALFESYVR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgaccttaccggcgaggaaagcgccgccgccgcgaggacgcgttcccgatcat
tgcgaaatgaatgctcgactaaccggccgccggtcaagtaatgtgcccgggaacagctgc
gaacgggggagcagctcagccgcgtctggtttcacaccgcaaccaccgggggaagttttg
ttcgacaatatccacgccattgccgctgaccggaaatggcggccgatcaaagacaccgaa
cacatcctgaccgccgcgggcgcgcacaacggcctgagcgcgcgcctggtggacgaggcc
ggcttcgacttcgtctgggcgagcggcctcgagatctcggcatcgctcgggctcgcggac
gccgacatcgtcgggcgcaccgagtccgcgcaagcggtgagcgcgatcctgcgggccact
tccctgcccgtgatcgtcgactgcgacgcgggatacggcaacgcggtcaacgcctggcac
accgcgcagcactacttcgcggcgggcgtctacggcctctgcctggaggacaagacgttc
ccgaagatgaacagcttcgtcgagcacagccacgccctgatccccgccgcgaccatggcg
ggcaaggtcgaggcgatgctggactgcaaggtcgtcgagcagcagcaggtcatcgcgcgc
accgaggccctgatcgcgggcgcgagcgtcgacgaggccctcgaacgcggcctcgcctac
gccgaagcgggcgccgacgccgtgctcgtccacgacaagacgaagcacgcggagaaactc
ctcgagttcgccgaacggtggacctcgccgacgccgctcgtctgcgtgccgacgacctac
tacgagttcaccaccaaggaactcggcgaggccgggttctccctggccatctacgccaac
caggggatccggtcccagatcgcggccgtcaagcgcgtgctgacgcagatccgcgccaac
gggagcagccgcgacgtcgaggacgagatcgccccggtgaaggaagtcttcgccctgcaa
cgcctcgacgaggtctcggcgctgttcgaaagctacgtcaggtga

DBGET integrated database retrieval system