KEGG   Amycolatopsis sp. AA4: CU254_05900Help
Entry
CU254_05900       CDS       T05278                                 

Definition
(GenBank) type I polyketide synthase
Organism
amyc  Amycolatopsis sp. AA4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Acyl_transf_1 Ketoacyl-synt_C KR PS-DH KAsynt_C_assoc PP-binding Thiolase_N adh_short Epimerase GDP_Man_Dehyd Polysacc_synt_2 NmrA ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ATY10046
UniProt: A0A2K8LNR2
LinkDB All DBs
Position
1203594..1218911
Genome map
AA seq 5105 aa AA seqDB search
MTTLENAAGEVAVIGMSCRLPQAPDPAALWRLLRDGGNAIADPPPGREPGLARGGFLDAV
DTFDPAFFGISPREAAAMDPRQRLVLELAWEALENAGIVPRALHGTDLSVVVGAIGDDYA
AITHGLGERATTRHTLAGTQRGMLANRVSYLLGARGISMTVDTAQSSSLVAVHLACESLR
SGASTLALAGGVNLNLAPETTAAVAEFGALSPDHQCFTFDERANGYVRGEGGGLVVLKPL
ARALADGDRIHAVISGSAVNNDGETEALVVPSADAQRDVIRAAHARAGHDPAAVQYVELH
GTGTRRGDPIEAAALGAALGEGRDEPIEVGSAKTNVGHLEGAAGIVGLIKTVLAIRHRVL
PASLNFERPNPDLPLAALNLSVRRATGPWPRPDRRLVAGVSSFGMGGTNCHVVLAEAPAS
APEAPAERGEAPAWWLVSGRDEAALRAQARALNEAISEDTDEIEVARALATTRTHFAHRA
VIVGSGRDDLRAGLAALESGERPGSLVVGTAVEPGAPAFLFTGQGSQRPGMGKRLAQTYP
VFAEALDEICGHFDQYFDRRLRTLMFADEGTPDAALLDETHYAQAALFAFEVALFRLFEH
WGVRPAVLLGHSIGELAAAHVAGVFGLTDACALVAARGHLMYALPARGTMLSVSASVDEV
RPLLLGREAEMNIAAVNGPAATVVAGDDDAVAALATALEQRGHRTKRLRVTRAFHSPHMD
AILDDLRVAAAEVQYAPPRIPVVSNLSGELAAGSDLTSPEYWVQHARRAVRFHDGVRGLL
ASGTNTFVELGPDSVLSVAGRAAADGKAMFVPAVRRHLDESTAVSLALARLHVHGLALDW
TRLLGTSRLELPTYQFQRQRYWVGESVETATETLVPQANPDRDLLDVVRTAVRAVLGLAP
GDAVDPAAAFKDLGFDSLGLLELRDRLVELTGSPLDATVLYNHPTPDALARHLRGGQDTA
VPVVAAPSVPVHDDAIAIVGMGCRFPGGVNSPGELWDLVAEGRDAIGGFPVNRGWDLGGL
FDPDPGRAGRSYVREGGFLPDADEFDAEFFGISPREALAMDPQQRLLLEVAWETLERAGI
DPASLAESRTGVFVGATAQEYGPGLSAGSDGFALTGGTTSVASGRIAYALGLHGPALTVD
TACSSSLVAIHLATQALRRGECSLALAGGVTVLATPGMFVEFSKQRGLAPDGRCKPFAAA
ADGTAWAEGAGILALERLSDARRNGHHVLAVVRGSAINHDGASNGLTAPSGRAQERVIRD
ALADAGLSFVDVDVVEAHGTGTTLGDPIEANAILATYGQERDRPLWLGSLKSNIGHAQAA
AGVGGVIKSVLAMRHGVLPKTLHVDAPSPHVNWSAGSVKLLTEPVEWESEGPRRAAVSSF
GISGTNAHLVLEQAPTEPEAPETPAPAHPLPFVLSARADSALRAQAERLLDRLTPDDNLA
DLAFSLATTRTSHPRRAVLVAEDHDQLRERLTALARGENAAGAVPASGKVVFVFPGQGTQ
WAGMARELLSASPVFAASIEACERALDPFVAWKLTDVLHQRADAPSLDRVDVIQPALFAV
MVSLAELWRAFGVHPAAVVGHSQGEIAAAYIAGALSLSDAAKIVALRSRALVALGGRGGM
ASVQLAAAAVRERLAAAGGALQVAVVNGPLSTVVAGPAEAVDEFLVACERDGVQARRIAV
DYASHSAMVEEIEAELATVLDGTQPSASRIPFYSTATASVLDTTSLDADYWYRNLRGTVE
FERTTRLLLETGHTTFIECGPHPVLASALHETAEAAGAAATVLGSLRRDDGGLDRFFESL
GQAYGHGLPVDWTAALDPAAKRVDLPTYAFQHERFWLDAGRDADPSSLGLSPAEHPMLGA
VVELGDGDGVVCTGKLSTRSVPWVADHMVFGTVLVPGTAFVDLVLEAGRHVGCDRIAELT
LPAPLPLSGEDGVRLQVLVGAVDGGRRPVTVYAESSDGRQVHAVGTLASGGADAVSTMDW
PPRGAERMNLDGVYDRLADSGYDYGPAFQGLRAAWRRGDEIFAEVETPADSIGSGVHPAL
TDAALHAVVLGMDEPVLPYAWRDVRFTGVPAAKLRVHSTPVGAGTVRLVMTDDEGQLVAE
VGSLALRPFSPSLLAEDSRRLLRMTWPVLAATDRRAEAPDAVFVCERGQSVAAATTCVLE
RLQAFLAEDQTGGKLAVVTEGAVSTSDADRDVDLAGAAVWGLVRSAQAENPGRFVLLDRD
SGTADLTGALASGEPQLAVRDGELRVPRLAPAAGTSRQLDPHGTVLVTGGTGTLGGLLAR
HLVARHGIRHLLLLSRRGTAPELQAELTALGADVTIKACDAADRDALAKVLADVPSAHPL
TAVVHAAGVLDDGILLSLSEHRLDTVLRPKATAAWNLHELTRDHDLAAFVLFSSVVATVG
GPGQANYAAANGFLDGLAVRRASEGLPAVSIAWGLWADASGMTGAMAELDIARMGRRGIA
PLRAEDGLALFDEILGIGEPVAVAAALDTASLRRQARTDELPVVFGELFRRPERRAGQAP
VALAELLAGRSEREQDEICRSVVMTEAAAVLGHGSGDAIAPDRTFKDLGVDSLIGLELRN
RLVAATGVRLASTLVFDYPTPAELAAHLRAELGDRDVTPVAVAPSVPADEDAIAIVGMSC
RYPGGVTSPEELWDLVAAGRDAVGSFPENRGWDLAGLFDPDPARAGRSYAREGGFLYDAD
EFDAEFFGISPREALAMDPQQRLLLEVAWESLERAGIAPKSLRGSDTGVFTGVMYGDYRS
RLPKVPEDLEGQLGNGSHTSVASGRISYTFGWHGPALTVDTACSSSLVAIHLAAQALRRG
ECSLALAGGVTVMATPATFVEFSRQRGLSPDGRCKSFAAAADGTAFGEGAGLLVLERLSD
ARRNGHDVLAVVRGSAVNHDGASNGLTAPSGPSQERVIRQALAEAGLSSVDVDVVEAHGT
GTKLGDPIEANAILATYGQERDRPLWLGSLKSNIGHTQAAAGVGGVIKAVLAMRHGVLPK
TLHVDEPSPHVDWSTGSVQLLTEKVDWESEGPRRAAVSSFGISGTNAHLILDQALTEPEA
PERPAPAYPLPFVLSARTAPALRAQAETLLGHLTPDHHLADVAFSLATTRNVHEYHAVVV
ANDHDQLRKRLTVLANTETTTRPHGRTAVMFTGQGAQRPGMGQQLYEAFPVFAAAFDELC
AHFDAHLDRPLRELISDPAALDQTGYAQPALFAFEVSLYRLFEHWGLAPDHLIGHSLGEL
VAAHVAGVLTVEDATALVAARGALMQNLPANGAMVAIEAEEAEVLPLLGPAVSVAAVNGP
RAIVVSGAKQEVAEVAAAFRERGQRTKPLNVSHAFHSALMEDMLEDFHRVAQGLSYAQPR
IPVVSNTTGELVTDDIATPAYWVRHVREGVRFHDGVKTLERAGVTTFVEIGPEPVLTALG
RETAPDAAFLFTSTGKRSETETVAAALGDLHVRGIAIDWPAFFATTGARRTSLPTYPFQR
RSYWLDAPAVSGEPSAIGQHATGHPLLTTAVPLAAGGRVLTGRLSRSAQPWLAQHTVGGK
TLVPSTVFAELALRAGSLTGAAQLRELTVEEPLVLPAEGDVRLQLTIGEADEEGRREIGF
HAQPGSADSGEPWTRHATGVLAAGEHAGHEDLSAWPPPGASEVDVTELYDGLADNGYDYG
ELFRGLTAAWRRGDEIFAEVRLPKQAEDDGFAVHPALLDSALHTVFVSERSGSAPVVPFS
WRDTTLTRTDATNLRVALSRSGEQTVRLVLADDQGMPVGSVGELRLRPIRTAPASRSLLR
MAWRPTAAGHPAVTGAVLGDKPDGLAAEPYLDLAALREVLRNGSPVPEFVVVPCREGSGD
VPGATSAAVHAVLGLLNEWLADPELSNAKLVVVTSGAVRAKADEELANLPQAAVWGLVRS
AQTEHPGRLVLADLDDDVRSWQALAGAVAGGEPQLAIRQGVATAARLVRTAEPGRGDVRE
PDSNGTVLVTGGTGALGSLVARHLVTRYGARHVLLASRQGPAAPGAAALETGLKALGAEA
RIVRCDTADPDALADLLATVPPENPLTAVVHTAGVLDDGVLASLTPERVDAVLRPKVDAA
WHLHRLTAHLDLSMFVLFSSVAGYVGTAGQANYAAANTFLDALAEHRRSLGLSGTSVAWG
LWDGASGMAGGLGETDRARLSRMGIAPLSEDAGLALFDLAVRHEAAALVAAPIDQAALRT
ANGSVVPMLRDLVRDRIQRNHAPSSPGKRLAGLPETEQYRSVLALVRTEAATVLGYDDAS
AIEAGRAFSELGFDSLMAVELRNRLTAATDVTLPTTLVFDHPTPEALAGHVRTMLTGATG
PAAVPLTTTPAASGDDIAIVAMSCRYPGGVTSPEDLWQIVAEGTDAISGFPTDRGWDLAS
LYDPDRTRPGTSYTAEGGFLRDADQFDADFFGMKEIEALATDPQQRLLLELTWEALERAG
IDPARLRGSDTGVFAGVMYNDYGARLMADPGGLEGYLSTGSSGSVASGRVAYTFGFEGPA
ISIDTACSSSLVALHWACQAIRQGDCSMALAGGVAVMSTPATYVAFSRQRGLSPDGRCKA
FAASADGTGFAEGAGLLLLERLSDARREGHPVLAVIRGSAINQDGASNGLRAPSGRAQER
VIRQALASSGLSPADVDAVEAHGSGTSLGDPIEANALLATYGQRPAGRPLWLGSVKSNIG
HTQSAAGVAGVIKMIMAMQHGVLPRTLHVDQPTPRVDWSSGAVSVLTEPVRWPDDERPRR
AGVSSFGVSGTNAHVIIEQASPSAAPDSNALTDDLPWLISARTPEALRGQARLLHQHARD
AGTAEVAHALATTRAAFKHRAVLLGRNREELLSATRDLADGLSTENVVLGTAGGATAIAF
SDGAAGLSTRELYRAFPAYAAELDRVCAALDRRLDRPLRDLLLQGAEADYAEYARSAAFA
RETALFGLLAEWGVRPDYVFGQGIGEVTAAYIAGMVPLTEACELVATGTRTASAPAAPRF
PLISTVTGKIATGDELATAEYWSEYRNGACRLEDAVATLRERNVHAVLDLGQHFDPADPS
MTFIPVLGKNTTAVRALLKALAIAHAGGLQVDWTTVTGGPAVPDLPTYAFERKRYWLDST
AGLPI
NT seq 15318 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaccctggaaaatgccgcgggcgaagtcgcggtgatcggaatgtcgtgccggctg
ccccaggctcccgatccggcggctttgtggcggctgctgcgcgacggcgggaatgcgatc
gccgatccgccgcccggccgggagccggggctggcccggggcggcttcctcgacgccgtc
gacactttcgacccggcgttcttcggcatctcgccgcgcgaggcggcggcgatggacccg
cggcagcggctcgtgctcgaactggcgtgggaagcgctggagaacgcggggatcgtgccg
cgcgctctgcacggcaccgacctgagcgtcgtcgtcggcgcgatcggcgacgactacgcc
gcgatcacccacgggctcggcgaacgcgcgacgacccggcacacgctcgccggcacgcag
cggggcatgctcgccaaccgggtttcgtacctgctgggcgcgcgcgggatcagcatgacc
gtcgacaccgcccagtcgtcgtcgctggtggcggtgcacctcgcctgcgaaagcctccgc
agcggggcgagcacgctcgcgctcgccggcggcgtgaatctgaacctcgcgccggagacg
acggcagcggtggccgagttcggcgccctgtcgccggatcaccagtgcttcaccttcgac
gaacgggccaacggctacgtgcgcggcgagggcggcgggctggtggtgctcaagccgctc
gcgcgggccctcgcggacggcgaccggatccacgccgtgatttccggcagcgcggtcaac
aacgacggcgagaccgaggctctcgtcgtgccgagcgccgacgctcagcgggacgtcatc
cgcgcggcgcacgcgcgagcgggccacgatcccgccgcggtgcagtacgtggagttgcac
ggcaccgggacgcgacgcggcgatccgatcgaggcggcggcgctcggtgcggcactgggc
gaggggcgggacgaaccgatcgaggtcggatcggccaagaccaacgtcgggcacctcgaa
ggcgccgccgggatcgtcggcctgatcaagaccgtgctggcgatccggcaccgggtgctg
cccgcgagcctgaacttcgagcggccgaacccggacctcccgctggccgcgctcaacctc
tccgtgcgacgggcgaccgggccgtggccgcggccggaccggcggctggtcgccggggtg
agttcgttcggaatgggcgggacgaactgccacgtcgtgctcgccgaagcaccagcctcg
gctcccgaagcaccagcggaacgcggcgaggcaccggcgtggtggctggtgtcgggccgg
gacgaagccgcgctgcgggcacaggctcgggcgctgaacgaagccatttccgaggacacc
gacgaaatcgaggtcgcccgcgcgctggcgaccacccgcacccatttcgcccaccgcgcg
gtgatcgtcggctccggccgcgacgacctgcgcgctggactcgccgcgctcgagtcgggc
gagcgtccgggctccctggtcgtcggcaccgccgtcgaaccgggcgcgcccgcgttcctg
ttcaccggccagggttcgcaacggccggggatgggcaagcggctcgcccagacctatccg
gtgttcgcggaagcccttgacgagatctgcgggcatttcgaccagtacttcgaccggcgg
ctgcggacgctgatgttcgctgacgagggaacgcctgacgcggcgctgctcgacgagacg
cactacgcccaggccgcgctgttcgccttcgaggtcgcgctgttccggttgttcgagcac
tggggcgtgcgtcccgcggtgctgctggggcactcgatcggcgaactggccgctgcgcac
gtcgccggagtgttcgggctgacggacgcctgcgcactcgtcgccgcacgcgggcatttg
atgtacgcgctgcctgcccggggcacgatgctctcggtctcggcgagcgtggacgaggtg
cggccgttgctcctcggccgcgaagccgagatgaacatcgctgcggtcaacggtccagct
gcgaccgttgttgccggagacgacgacgccgtcgccgcgctcgcaacggcgctcgaacag
cgcgggcaccggacgaagcggcttcgggtgacccgtgccttccactcgccgcacatggac
gccatcctggacgacctccgggtggcggctgccgaggtccagtacgcgccgccgcgcatc
ccggtcgtgtcgaacctgagcggagagctagccgcgggcagcgacctgacttccccggag
tactgggtgcagcacgcgcgacgcgcggtgcggttccacgacggcgttcgcggtctgctg
gcctccggcacgaatacgttcgtcgaactcggcccggacagtgtgctcagcgtcgccggt
cgggccgctgcggacgggaaagcgatgttcgtcccggcagtgcgccggcatctggacgaa
agcacggcggtcagcctcgctctggcacggctgcacgtgcacggtctcgcgctggactgg
acgcggctgctcgggacctctcggctcgaactgccgacctaccagttccagcgacagcgg
tactgggtgggcgaatcggtcgaaactgccaccgaaacgcttgtcccgcaggcaaacccg
gaccgcgacctgctcgacgtggtccgtacggcggtgcgcgcggtcctgggcttggcgcct
ggggacgcggtggacccggcggccgcgttcaaggacctcgggttcgactccctcggcctg
ctggaattgcgtgaccggctcgtcgagctgaccggttcgccgctcgacgcgaccgtgctc
tacaaccacccgaccccggacgccctggcccggcacctgcgcggcggtcaggacacggca
gtgcccgtagtagccgccccgagtgtcccggtgcacgacgacgcgatcgcgatcgtcggg
atgggctgccggttcccgggcggggtgaactcgccgggggagctgtgggacctggtggcg
gagggccgcgacgcgataggcggttttccggtgaaccggggctgggatctgggcggattg
ttcgatccggacccgggccgggcgggccggtcgtacgtgcgggaagggggtttcctgccg
gacgcggacgagttcgacgcggaattcttcgggatcagcccgcgcgaggcgctggcgatg
gatccgcagcagcggctgctgttggaggtcgcctgggagacgttggaacgcgccgggatc
gaccccgcttcgctggccgaaagccgcaccggagtgttcgtcggggcgaccgctcaggag
tacggcccggggctttccgcgggttcggacggattcgcgctcaccggtgggaccacgagc
gtcgcctccggccgcattgcctacgcactggggctgcacggcccggcgctgacggtggac
acggcgtgctcgtcgtcgctggtggcgattcaccttgcgacacaagcgttgcggcgcggc
gagtgttcgctggcactggcgggcggcgtgaccgtgctggccacgccggggatgttcgtg
gagttcagcaagcagcgcggactggccccggacggccggtgcaaaccgtttgccgcggcc
gcggacgggacggcctgggcggagggcgcgggaatccttgcgctggaacgactgtcggac
gcgcggcgcaacggccaccacgtgttggctgtggtgcgggggagcgcgatcaaccacgac
ggagccagcaatggcttgaccgcgccgagcggccgggcacaggaacgggtcatccgggat
gccctcgcggatgccggattgtcctttgtggacgttgacgtcgtggaggcgcacggcacc
ggcacgacgctgggcgatccgatcgaagctaacgcgattctggcgacctacggccaggaa
cgggaccgtccgttgtggcttggttcgctgaagtcgaacatcgggcacgcgcaggcggcc
gcgggcgtgggcggggtgatcaagtccgtgctggcgatgcggcacggggtcctgccgaag
acgttgcatgtcgacgcgccgagtccgcacgtgaactggagcgcgggttcggtaaagctg
ctgaccgagccggtggagtgggagagcgagggcccgcgacgggcggcggtgtcgtcgttc
ggaatcagcggcaccaacgcgcatctcgttctcgaacaggccccgacggaaccggaagca
ccggaaacgcccgccccggcgcacccgttgccgttcgtgctgagcgcgcgcgccgactcc
gcgttgcgggcgcaggccgagcggttgctcgaccggctcacccctgacgacaacctcgcc
gacctcgccttctcgctggctaccacccgaacctcgcacccgcggcgcgcggttctcgtc
gcggaggaccatgaccagctccgggaacggctcaccgctctcgcgcgcggggaaaacgcg
gccggggcagttccggccagcggcaaggtcgtgttcgtgttccccggccagggcacgcag
tgggcgggcatggcgcgggaactcctgtcggcgtccccggtgttcgccgcgtcgatcgag
gcctgcgagcgggcgctcgatccgttcgtggcctggaagctgaccgacgtcctgcaccag
cgggcggacgcgccgtctctggaccgggtcgacgtcatccagccggcgctcttcgcggtg
atggtctcgctcgccgaactgtggcgcgcgttcggcgtccatcccgcggccgtggtcggg
cactcccagggagaaatcgccgccgcgtacatcgccggggcgctcagtctttccgacgcc
gccaagatcgtggcactgcgcagccgggcgctggtcgcgctcggcggacggggcggcatg
gcgtcggtccagctggccgcggccgccgtgcgggagcggctggccgccgcgggcggggcg
ctgcaggtcgcggtcgtcaacggtccattgtcgacggtcgtggccggtccggcggaggcg
gtcgacgagttcctcgtcgcctgcgaacgcgacggcgtgcaggcccggcggatcgcggtc
gactacgcctcgcattccgcgatggtcgaggagatcgaggcggagctggccaccgtgctc
gacggcacgcagccctccgcctcgcggatcccgttctactcgacggcgaccgcgtccgtg
ctggacaccaccagcctggatgccgattactggtaccgcaacctgcgcggcaccgtcgag
ttcgaacgcacgacacggctgttgctcgaaaccgggcacacgacgttcatcgaatgcggc
ccgcatccggtgctggcctcggcgctgcacgaaaccgccgaggcggcgggcgcggccgcg
acggtcctcggctcgctgcgtcgcgacgacggcggcctcgaccggttcttcgagtccctc
ggccaggcttacggccacggcctcccggtcgactggactgccgcgctcgacccggccgct
aagcgggtcgacctgccgacctacgccttccaacacgagcggttctggctggacgccgga
cgcgacgccgacccttcctcgctcgggctttcgcccgcggaacacccgatgctgggcgca
gtggtcgaactcggggacggcgacggcgtcgtctgcaccgggaagctgtcgacgcggtcc
gtcccgtgggtggccgaccacatggtgttcggcacggtcctggtgccggggacggcgttc
gtggacctggtgctcgaagcgggacgccacgtcggctgcgaccggattgccgagctgacc
ctgcccgcgccgctgccgctttccggcgaggacggcgtccggctgcaggtcctggtcggt
gccgtcgacggcggccgacgcccggtgacggtgtacgccgaatcctccgacggcaggcag
gtgcacgcggtcggaacgctggccagcggcggtgccgacgcagtgtccactatggactgg
ccgccgcgcggggcggagcggatgaacctcgacggggtgtacgaccgcctcgccgacagc
ggatacgactacggccccgccttccagggcctgcgcgcggcctggcgacgcggcgacgag
atcttcgccgaggtggagaccccggccgacagcatcggttccggcgtacacccggcgctc
accgacgcggccctgcacgcggtggtcctcggcatggacgagccagttcttccctacgcg
tggcgcgatgtccgcttcaccggagtaccggcggcgaagctgcgcgtgcacagcactcct
gtcggtgctggcaccgttcgcctggtcatgaccgacgacgaaggccagctcgtggccgaa
gtcggttccctggcgctgcggccgttttcgcccagcctgctcgcggaagacagcaggagg
ctgctgcggatgacgtggccggtgctggccgccacggatcgccgcgccgaggcaccggat
gcggtattcgtctgcgagcgtgggcaaagcgtcgcggcggcgaccacgtgcgttctcgaa
cggctgcaggccttcctggccgaagaccagaccggcggcaagctggccgtcgtcaccgag
ggcgcagtgtccacttcggacgcagaccgggacgtcgacctggccggtgcggcggtctgg
ggcctcgtgcgatccgcgcaagccgaaaaccccggccgattcgtcctgctcgaccgcgac
tccggcaccgccgacctgaccggggcgctggcctccggcgagccgcaactggcggtgcgc
gacggggaactccgcgtaccgcggctcgccccggccgccggaaccagtcgccagctcgat
ccccatggcaccgttctcgtcaccggcggcaccggcacgctcggcggattgctggcccgc
cacctcgtggcccggcacgggatccgccacctcctgctgctcagccgccggggcaccgcc
cccgaactgcaggccgagctgaccgcactcggcgcggacgtcacgatcaaggcctgcgac
gcggccgaccgcgacgcattggcgaaggttctggcagacgttccctcggcccatccgctc
accgcggtcgtgcacgccgccggggtcctggacgacggaatcctgttgtccctgtcggag
caccgcctcgacacggtcctgcgaccgaaggccaccgccgcctggaacctgcacgagctc
acgcgggaccacgacctggccgcgttcgttctgttctcgtcggtcgtcgccaccgtcggc
ggcccggggcaggcgaactacgccgcggccaacggtttcctggacgggctcgccgtccgc
cgcgcgagcgagggcttgcccgccgtttcgatcgcctggggcctgtgggccgacgcgagc
gggatgaccggtgccatggccgaactcgacatcgcgcggatgggtcggcgcggcatcgcg
ccgttgcgtgccgaggacggtctcgccctgttcgacgagatcctcggcatcggcgaaccg
gtcgccgttgcggcggcactggacacggcttccttgcgtcggcaggcacgcacggacgag
ctgccggtggtcttcggcgagctgttccgccgcccggagcggcgggcgggccaggccccg
gtcgcgctcgccgaattgctggccggacggtccgaacgggaacaagacgagatctgccgg
tccgtcgtcatgaccgaggcggccgccgtgctcggacacgggagcggcgacgcgatcgcc
cccgaccgcacgttcaaagacctgggcgtcgactccctgatcggactggagctgcgcaac
cggctcgtcgcggcaaccggggttcggctcgcgagcaccctggtgttcgactatccgact
ccggccgaattggcggcgcacctgcgcgctgaactcggtgaccgcgacgtcacgcccgtg
gcggtcgccccgagtgtcccggcggacgaggacgcgatcgcgatcgtggggatgagctgc
cgatatccgggcggggtgacctcgccggaggaactgtgggacctggtggcggcgggccgc
gacgcggtggggagtttccccgagaaccgcggctgggacctggccggtttgttcgacccg
gatcccgcccgcgcaggccggtcgtacgcgcgagaagggggtttcctgtatgacgcggac
gagttcgacgcggagttcttcgggatcagcccccgcgaggcgctggcgatggacccacag
cagcggctcctgctcgaagtagcctgggaatcgctggaacgcgcggggatcgcaccgaag
tccttgcgcggcagcgacaccggcgtgttcaccggggtgatgtacggcgactaccgctcg
cggctgccgaaggttcccgaggatctcgaaggccagctcggcaacggcagtcacacgagt
gtcgcgtccggccggatctcctacacgttcggctggcacggcccggcactcacggtggac
acggcgtgttcgtcgtcgctggtggcgattcaccttgcggcgcaggcattgcggcgcggg
gagtgttcgcttgcgctggcgggcggcgtgaccgtgatggccacgcccgccacgttcgtg
gagttcagtcggcagcggggactgtctccggacggccggtgcaagtcgttcgccgctgcc
gccgacggcacagcattcggcgaaggcgccgggttgctcgtgctggagcggctgtccgac
gcgcgccgcaacggccatgatgtgctggccgtagtgcgggggagcgccgtcaaccacgac
ggggcgagcaatggcctcaccgcgccgagtggtccgtcgcaggagcgcgtgatccggcag
gcccttgcggaggctggtttgtcctctgtggacgttgacgtcgtggaagcgcacggcacg
ggcacgaagctgggcgatccgatcgaggccaacgcgatcctcgcgacctacgggcaagag
cgggaccgtccattgtggctgggttcgctgaaatcgaacatcgggcatacccaagcagca
gctggcgtcggcggggtgatcaaggccgtcctcgcgatgcgacacggcgtgttgccgaag
accttgcacgtggacgagccgagcccgcacgtcgactggagcacgggttcggtgcagctc
ctgaccgagaaggtcgactgggagagcgaggggccgaggcgcgccgcggtgtcgtcgttc
ggaatcagcggcaccaatgcccatctcattctcgatcaagccctgacggagccggaagca
ccggaaaggcccgcccccgcgtatccgctgccgttcgtactgagcgcgcgaacggctccg
gcgttacgagcacaggccgaaaccctcctcggccacctgaccccggaccaccacctggcc
gacgttgcgttttcccttgccaccactcgaaacgtccacgagtaccacgccgtcgtcgtc
gcgaacgaccacgaccagctccggaaacggctcaccgtactcgcgaacacggagacgacg
acgcgcccccacggccggaccgcggtcatgttcaccggacagggcgctcaacggccggga
atgggacagcagctctacgaggccttcccggttttcgccgccgcgttcgacgaactctgc
gcgcacttcgacgcgcacctggaccgtccgctgcgcgagctgatctccgaccccgccgcg
ctcgaccagaccggctacgcgcagcccgcgttgttcgccttcgaggtctccctgtaccgg
ttgttcgagcactggggactggccccggaccacctgatcggccattcgctcggtgaactg
gtcgccgcacacgtcgccggggtgctgaccgtcgaggacgccaccgcgctcgtcgcggcg
cgcggcgcgctcatgcagaatctgcccgcgaacggagccatggtcgcgatcgaagcggaa
gaggccgaggtcctgccgctgctggggcccgccgtgtccgtcgcggcggtgaacggcccg
cgggcgatcgtcgtctcgggcgcgaagcaggaggtcgcggaagtcgccgcggccttccgg
gagcgcggccagcggaccaagccgctgaacgtcagccacgcgttccactcggcgctgatg
gaagacatgctcgaggacttccaccgcgtcgcgcagggcctttcctatgcccagcccagg
attcccgtggtttccaacacgaccggcgagctggtcacggacgacatcgcgacgcccgcg
tactgggtgcggcacgtccgggagggggtgcgcttccacgacggcgtcaaaacgttggag
cgcgcgggtgtcaccacgtttgtcgagatcggcccggaacccgtgctgaccgcgctcggc
cgcgaaacggctcccgacgccgcgttcctgttcacctcgaccggcaagcgatccgaaacg
gagacggtggctgccgcgctcggcgacttgcacgtccgcggaatcgcgatcgactggcca
gccttcttcgcgaccaccggcgcccgccgcacgtccttgcccacctacccgttccagcgc
cggtcttactggctcgacgcgcccgcggtctcgggcgaaccgtcggcgataggccagcac
gcgaccggccacccgctgctcacgacagccgtgccgctggccgcgggcggccgggtgctg
accggacggctgtcccgatcggcccagccttggctcgcccagcacacggtcggcggaaaa
accctcgtgcccagcaccgttttcgccgaactggcgttgcgcgccggcagcttgaccggt
gccgcgcagctgcgggaactgactgtggaagagcccctcgtcctgcccgccgagggcgac
gtccggctccagctgacgatcggggaggcggacgaggagggcaggcgcgagatcggtttc
cacgcccagcccggatcggccgactccggcgagccgtggacccggcacgccaccggcgtc
ctcgccgcgggagagcacgccgggcacgaagacctgtccgcctggccgccgcccggcgcg
agcgaggtcgacgtcaccgagctttacgacgggttggcagacaacggttacgactacggc
gagctgttccgcggcctcaccgccgcgtggcgacgaggcgatgagatcttcgcggaagtt
cggctgcccaagcaagccgaggacgacgggttcgccgtgcacccggctttgctggactcc
gcgctgcacaccgtgttcgtgtccgagcgctccggcagcgcgcccgtcgtgccgttttcc
tggcgcgatacgacattgacccgcaccgacgcgacgaatctgcgcgtcgcactgtcgcgg
tccggtgagcaaacggtgcgactggtgctcgccgacgatcagggcatgccggtcggttcc
gtcggcgaactgcggctcaggccgatccgcaccgccccggcgtcgcggtcgctgttgcgg
atggcgtggcggccaaccgcggcgggccacccggcggtcaccggcgcggtgctcggcgac
aagcccgacgggctggcggcggagccctacctcgacctggccgcgctgcgcgaagtcctc
cggaacggcagcccggtgccggagttcgtcgtggtgccgtgccgcgaaggcagcggagac
gtgcccggtgcgacgagcgccgccgtgcacgccgtgctcggcctgctgaacgagtggctc
gccgatccggaactctccaacgcgaagctggtggtcgtcacgtccggcgcggtccgcgcg
aaggccgacgaggaactggcgaacctgccgcaggcggccgtgtgggggctggttcgcagc
gcccagaccgagcatccgggacggctcgtgctcgccgacctcgacgacgacgtgcgctcg
tggcaagccctcgccggcgcggtggcgggcggcgaaccccagctggcgatccgccaaggc
gtcgcgaccgcggcccggctggtccgcaccgccgaaccgggccgcggcgacgtccgcgaa
ccggactcgaacggaacggtgctcgtcaccggaggcaccggtgcgctcggctcgctcgtc
gcccgccacctcgtgacccgatacggagcccggcacgtcctcctggccagcaggcaaggc
cccgcggcaccgggagcggccgcgctggagaccgggctcaaggctctcggtgccgaggcc
cggatagtccgctgcgacacggcggacccggacgcgctcgccgacctgctcgcgaccgtg
ccgccggaaaacccgctgaccgccgtggtccacaccgcgggagttctcgacgacggggtg
ctggcctcgctcactccggaacgcgtggacgccgtcctgcggcccaaggtcgacgccgcg
tggcacctgcaccggctcaccgcacacctggacctgtcgatgttcgtgctgttctcctcg
gtcgccggatacgtcggcaccgcgggccaggcgaactacgccgcggccaacacgttcctg
gacgcactggccgagcaccggcgttcgctcggcctcagcggcacctccgtggcgtggggc
ctgtgggacggcgcgagcggcatggcgggagggctcggcgaaacggaccgcgcccggctg
tcgcggatgggcatcgccccgctgagcgaggacgccggtctggccctgttcgacctggcc
gtccgccacgaggcggcggcgctggtggccgcgccgatcgaccaggcagccctgcgcacc
gccaacggctccgtcgtgccgatgctgcgcgacctcgtccgcgaccggatccagcggaac
cacgcgccgtcttcgccgggcaagaggctggccggactgccggagaccgagcagtaccgg
tcggtcctcgccctggtgcgcaccgaagccgccaccgtgctcggctacgacgacgcgtcg
gcgatcgaggccggccgcgccttcagcgaactcggcttcgactcgctgatggccgtcgaa
ctgcgcaatcgcttgaccgccgccaccgacgtcacgttgccgacgaccctcgtcttcgac
cacccgacgccggaggcactcgccgggcacgtccgcaccatgctgaccggcgcgaccggc
ccggccgcggtcccgctcaccacgaccccggccgccagcggcgacgacatcgcgatcgtc
gcgatgagctgccggtatccgggcggagtgacctcgccagaggacctgtggcagatcgtc
gccgaagggacggacgcgatcagcggcttccccaccgaccgcggctgggacctggcctcg
ctgtacgaccccgaccggactcgcccgggcacgtcgtacaccgccgagggcggcttcctc
cgagacgcggaccagttcgacgcggatttcttcgggatgaaggagatcgaggccctcgcc
accgacccgcagcagcggctcctgctggaactcacctgggaagcgctggaacgcgccgga
atcgacccggcgcggctgcgcggcagcgacaccggcgtcttcgcgggggtcatgtacaac
gactacggggcgcgcctcatggccgatccgggcggtctcgagggctacctgagcaccgga
agttccggcagcgtcgcctccggccgagtcgcctacacgttcggcttcgagggaccggcg
atcagcatcgacaccgcctgttcttcgtcgctcgtggcgctgcactgggcgtgccaggcg
attcggcagggcgactgctcgatggcactggccggcggggtagcggtgatgtcgacgccc
gcgacgtacgtggcgttcagcagacaacgcggcttgtcgcccgacggccgctgcaaggcg
ttcgcagcctccgccgacggcaccggcttcgccgagggcgcgggcctgttgctgctggaa
cggctctccgacgctcggcgcgagggccacccagtgctggccgtgattcgcggaagcgcg
ataaaccaggacggcgccagcaacggcctccgcgcaccgagcggccgggcgcaagaacgc
gtgatccgccaggcgctcgccagttcgggcttgtcgcccgccgacgtcgacgccgtcgaa
gcgcacggcagcgggaccagcctcggcgacccgatcgaggccaacgcgctcctcgcgacc
tacggtcagcgtcccgcgggccgtccgctctggctgggctcggtcaagtccaacatcggg
cacacccagagcgcggcaggggtggccggggtgatcaaaatgatcatggcgatgcagcac
ggcgtgctgccccggaccctgcacgtcgaccagccgacgcctcgggtggactggtcgtcc
ggcgccgtctccgtgctcaccgaaccggtgcgctggcccgacgacgaacgcccccggcgg
gcgggcgtgtcgtccttcggagtcagcggcaccaacgcgcacgtgatcatcgaacaagcc
agcccctcggccgcgcccgactcgaatgccctgaccgacgacctgccgtggctgatctcc
gcccgcacccccgaggccctgcgcggacaagctcgcctcctccaccagcacgcgcgggac
gcgggcaccgcagaggtcgcgcacgcactggccacgacccgggcggcgttcaaacaccgc
gcggtgctcctcggacggaaccgggaagagctcctgagcgccacccgagacctcgcggat
ggactgtcgacagaaaacgtcgtcctgggaaccgccggcggcgcgaccgcgatcgctttc
tccgacggtgcagcgggtctttccactcgcgagctctaccgcgctttcccggcatatgcc
gcggaactggaccgggtctgcgccgccctcgaccgccgtctggaccgtccgctccgcgat
ctcctgctccaaggcgccgaggcggattacgccgaatacgcgcgttccgcggcatttgcc
cgggaaacagccttgttcggattgctcgcggaatggggagtccggcccgattacgtgttc
ggccaggggatcggcgaggtgactgccgcgtacatcgccggaatggtcccgctcactgag
gcttgcgaactggtcgccaccggcactcggaccgcatccgctcccgccgccccgcgcttc
ccgctcatctccaccgtgaccggcaaaatcgccaccggcgacgagttggctactgctgag
tattggtccgagtaccgcaacggcgcctgccgactggaggatgccgttgccacccttcgc
gagcggaatgtgcacgcggttctcgacctggggcagcatttcgaccccgccgacccgtcg
atgaccttcattccggtgctgggcaagaacacgaccgcggtccgcgccctgctcaaagcc
ctggcgatcgcgcacgcaggtggtctgcaagtggactggaccactgtgacgggtggtcct
gctgttcccgatctgccgacgtacgcgttcgaacgcaaacggtattggctcgattccaca
gcgggtttgccgatctga

DBGET integrated database retrieval system