KEGG   Amycolatopsis sp. AA4: CU254_07905Help
Entry
CU254_07905       CDS       T05278                                 

Definition
(GenBank) rRNA (guanine-N1)-methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
amyc  Amycolatopsis sp. AA4
Brite
KEGG Orthology (KO) [BR:amyc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:amyc03009]
    CU254_07905
Enzymes [BR:amyc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     CU254_07905
Ribosome biogenesis [BR:amyc03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CU254_07905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_12 Methyltransf_11 Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: ATY10390
UniProt: A0A2K8LTN6
LinkDB All DBs
Position
complement(1657770..1658603)
Genome map
AA seq 277 aa AA seqDB search
MSLPDRVIDALRCSVCAEPVSLTGRTLRCERRHAFDLARQGYVNLLHARIPAGTADTAPM
VDARAAFLSSGAYAPLADAVAKAGSAPGLIIDAGAGPGYYLSRVLDNAPDAVGLALDVSA
IALRRAARAHARLGAAVWNLWEPWPVGDGVASVVLDVFSPRNAPEFHRVLAPGGKLVVAS
PLPGHLAELGDLVLAVDSRKEERLEAALGGLFVRESGVEVVRTQEFSAAQVRDVVAMGPA
GFHLDRDGRRERLEAAEGRDVTLAVSVSVWRKRDDVR
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgcctgatcgggtgattgatgcactgcgttgttcggtgtgcgcggagccggtc
tcgctgaccggccggacgctgcgctgcgagcggcggcatgcgttcgatctggcccggcag
ggttacgtcaatctcctgcacgcgcgcatcccggcggggacggccgacaccgcgccgatg
gtggacgcgcgggcggcgttcttgtcctctggtgcgtacgcgccactggccgacgccgtc
gcgaaggcgggttctgctcctggcttgatcatcgacgccggggctgggccgggctattac
ctctcgcgggtactggacaacgcgcccgacgccgtcgggctcgcgctggacgtctcggcg
atcgcgttgcggcgggccgcgcgggcgcatgcgcggctgggtgcggcggtgtggaacctg
tgggaaccgtggccggtgggcgacggggtggcttcggtggtgttggacgtgttctcgccg
cggaacgccccggagttccaccgggtgctcgcgccgggcgggaaactggtggtggcgtcg
ccgctgccgggccatctcgcggaactgggcgacctggtgctcgcggtggactcgcggaag
gaagaacggttagaggccgcgctgggcgggctgtttgtgcgggagtccggggtggaggtg
gtccggactcaggagttcagcgcggcacaggtgcgggacgtggtcgcaatggggcccgcg
gggttccatctggaccgggacggacggcgggagcggctggaggctgcggagggacgggac
gtgacgctggcggtttcggtgagtgtgtggcggaagcgcgacgacgtgcggtga

DBGET integrated database retrieval system