KEGG   Amycolatopsis sp. AA4: CU254_11035Help
Entry
CU254_11035       CDS       T05278                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
amyc  Amycolatopsis sp. AA4
Pathway
amyc00071  Fatty acid degradation
amyc00280  Valine, leucine and isoleucine degradation
amyc00281  Geraniol degradation
amyc00362  Benzoate degradation
amyc00592  alpha-Linolenic acid metabolism
amyc01100  Metabolic pathways
amyc01110  Biosynthesis of secondary metabolites
amyc01120  Microbial metabolism in diverse environments
amyc01130  Biosynthesis of antibiotics
amyc01212  Fatty acid metabolism
Module
amyc_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:amyc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CU254_11035
   00592 alpha-Linolenic acid metabolism
    CU254_11035
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CU254_11035
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    CU254_11035
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CU254_11035
   00642 Ethylbenzene degradation
    CU254_11035
Enzymes [BR:amyc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     CU254_11035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ATY10947
UniProt: A0A2K8LR80
LinkDB All DBs
Position
complement(2311251..2312450)
Genome map
AA seq 399 aa AA seqDB search
MRNVVFVEGVRTPFGKAGDKGMYAGTRADDLVVNAIRELLRRHPELPPERVDEVAIAATT
QIGDQGLTIGRTAALLAGLPKSVPGFAIDRMCAGAMTAVTTTASGIGFGAYDIAIAGGVE
HMGRHPMGEGVDPNPRIVADKLVDPTALVMGQTAENLHDRFPEITKERTDAFAARSQEKY
AEAVKTGKIGPELVPVATRSKELGWGLATEDEPPRPGTTVEQLAKLKTPFRPHGRITAGN
AAGLNDGATAAILADEDTARELGLPIGMRLVGYSFAGVEPEVMGIGPVPATEKLFKRTGL
SIDDIGLFEINEAFAVQVLAFLDHFGIADDDPRVNQWGGAIACGHPLASSGVRLMTQLAR
QFSERPDVRYGLTTMCIGIGMGGTVIWENPAYNGAEGAK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcaacgtcgtcttcgtcgaaggggtacgcacgcccttcggcaaggcgggcgacaag
ggcatgtacgccgggacccgggcggacgacctcgtcgtcaacgccatccgcgagctgctg
cggcggcatccggagctgccgcccgagcgcgtggacgaggtggcgatcgccgcgacgacg
cagatcggcgaccagggcctgaccatcggccgcaccgcggcgctgctcgccgggctgccg
aagtccgtcccgggcttcgcgatcgaccggatgtgcgcgggcgcgatgaccgcggtgacc
accaccgcgagcggcatcggcttcggcgcgtacgacatcgccatcgccggcggcgtcgag
cacatgggacgccacccgatgggcgagggcgtcgacccgaacccgcggatcgtcgcggac
aagctggtcgacccgaccgcgctcgtgatgggccagaccgcggagaacctgcacgaccgg
ttcccggagatcaccaaggagcgcacggacgcgttcgccgcgcgcagccaggaaaaatac
gccgaggcggtcaagaccggcaagatcggcccggagctggttccggtcgccacgcgcagc
aaggaactcggctggggcctcgcgaccgaggacgagccgccgcgcccgggcacgaccgtc
gagcagctggcgaagctgaagacgccgttccgcccgcacggccggatcaccgcgggcaac
gcggccggcctcaacgacggcgcgaccgcggcgatcctcgccgacgaggacaccgcgcgc
gagctcggcctcccgatcggaatgcgactggtcggctactcgttcgccggcgtcgagccg
gaggtcatgggcatcggcccggtgccggccaccgagaagctgttcaagcgcaccggcctg
tccatcgacgacatcggcctgttcgagatcaacgaggcgttcgcggtgcaggtgctcgcg
ttcctcgaccacttcggcatcgccgacgacgacccgcgcgtcaaccagtggggcggcgcg
atcgcgtgcggccacccgctggcctcgtccggcgtccggctgatgacgcagctggcgcgc
cagttctccgagcgtcccgacgtgcgctacggcctcaccacgatgtgcatcggcatcggc
atgggcggcacggtgatctgggaaaacccggcctacaacggcgccgagggggcgaagtaa

DBGET integrated database retrieval system