KEGG   Amycolatopsis sp. AA4: CU254_13450Help
Entry
CU254_13450       CDS       T05278                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
amyc  Amycolatopsis sp. AA4
Pathway
amyc00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:amyc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CU254_13450
Enzymes [BR:amyc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     CU254_13450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_14 DUF4350 Glyco_hydro_35 Glyco_hydro_2_C
Motif
Other DBs
NCBI-ProteinID: ATY11351
UniProt: A0A2K8LSM1
LinkDB All DBs
Position
complement(2859183..2861189)
Genome map
AA seq 668 aa AA seqDB search
MDRLYYGGDYNPEHWSPDVWAEDLKLMAEASVSMVTVGIFSWAQVEPRPGEFDFGWFDTV
MDNLASGGIRACLGTMTASPPPWLSHRYPEILPVRADGTRLSAGARQQFCPSSPVFREHA
ARLVEQVATRYAEHPALEMWHIGNEFGCHIRACYCDESAVDFRRWLAERYGTIEALNEAW
STTFWSQRYSEFAEIQPPRVAPTFPNPAHQLDYHRFSSDASLGCYLTEREVLARITPDIP
VTTNFVGLVQKSLDWNKWVPHEDIVSLDSYPDPYDPRGHLEAAFAYDLVRSLKDGQPWLL
LEQAPSAVNWRTRNSPKPPGTMRLGSWQAVARGADAVLFFQWRQTPGGAEKFHSAMVPHG
GPDTRIFREVRDLGQELASLPQLADSRVKADVALLHDWNSWWALELNSHPSDDLSQLDAH
LAHYAPLFDANVTCDVVHPSRELSGYRLVVVPNLYLMDSAVAANLRSYVEGGGHLVVSFF
SGIADENDRVYPGGYPAPLRDLLGLRVDEFWPLPESGATTLDLDGATVGAKIWSEWIEAE
GADVVATFAEGPLAGRPAITRHELGSGVAWYLGTRPDADVMRTLFDRITADAGVSPVLPG
LPDGVQAIVRHGSEDYLFLLNHNAEAVTVSLPSPGTDLLTDPAQPSSEVELAAHGVAVLS
GQFGTETR
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atggatcggctgtactacggcggggactacaaccccgagcattggtcgcccgacgtgtgg
gcggaagacctgaaactgatggccgaggcttcggtctcgatggtgactgtcgggattttc
tcctgggcgcaggtcgaaccacgtcccggggaattcgatttcggctggttcgacacggta
atggacaacctcgcttccggcggcatccgggcctgtctcggcaccatgacggcctcgccg
ccgccgtggctttcccaccgatatccggaaatcctgcccgtgcgcgcggacggcacccgg
ctgtccgccggtgcgcggcagcagttctgcccgtccagcccggtgttccgcgagcacgcc
gctcggctggtggaacaggtcgcgactcggtacgccgagcacccggcactggaaatgtgg
catatcggcaatgaattcggctgccacatccgcgcctgttactgcgacgagtccgcagtg
gacttccggcgctggctcgccgaacgctacggcaccatcgaggcgttgaacgaagcctgg
agcacgaccttctggtcgcagcggtactccgagttcgccgagatccagccgccgcgcgtc
gcgccgaccttcccgaacccggcacaccagctcgactaccaccggttctcgtccgacgct
tcgctgggctgctacctcaccgagcgcgaggtgctggcccggatcacgccggacatcccg
gtgaccacgaacttcgtcggcctggtgcagaagtcgctggactggaacaaatgggtgccg
cacgaggacatcgtgagcctcgattcctatcccgacccgtacgatccgcgcgggcacctg
gaagcggccttcgcctacgacctcgtccggtcccttaaggacggtcagccctggctgctg
ctggaacaggcgccgagcgcggtcaactggcgcacccgcaacagcccgaagccgccgggg
acgatgcggctgggcagctggcaggccgtcgcgcgaggcgcggacgcggtgctgttcttc
cagtggcggcaaacgccgggcggggccgagaaattccactccgcgatggtgccgcacggc
ggtccggacacccggatcttccgcgaggtgcgcgacctggggcaggaactggcgtcgctg
ccgcaactggcggacagccgggtgaaggccgacgtcgcgctcctgcacgactggaacagc
tggtgggcgctggagctgaactcgcatccgtcggacgacctcagccagctcgacgcgcac
ctcgcgcactacgcgccgctgttcgacgcgaacgtcacgtgcgacgtcgtgcacccgtcg
cgcgagctgtccggatatcggctcgtcgtggtgcccaatctgtacttgatggacagtgcg
gtcgcggccaatctaaggtcctatgtggagggtggcgggcacctggtggtgtcgttcttc
tccggtatcgccgacgagaacgaccgggtgtaccccggcggctatcccgctcccctgcgc
gaccttctcggcctgcgcgtcgacgagttctggccactgcccgagagcggtgccacgacg
ctcgacctcgacggcgccaccgtgggtgcgaagatctggtccgaatggatcgaagccgag
ggcgcggacgtcgtcgccaccttcgccgaaggcccgctggccgggcggcccgccatcacg
cggcacgagctcggctcaggcgtcgcgtggtacctcggcacgcggccggacgcggacgtc
atgcgcacgctgttcgaccggatcaccgccgacgccggagtttcgccggtgctgcccggc
ttgccggacggcgtccaggcaatcgtgcggcatggttccgaagactatctgttcctgctc
aaccacaacgctgaagccgtcactgtttccttgccttcgcccggtacagatttgctcacc
gatcccgctcagccatcgtccgaagtggaattggcggcacacggcgtggccgtcctctcc
ggacagttcggaacggagaccagatga

DBGET integrated database retrieval system