KEGG   Amycolatopsis sp. AA4: CU254_19835Help
Entry
CU254_19835       CDS       T05278                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
amyc  Amycolatopsis sp. AA4
Pathway
amyc00500  Starch and sucrose metabolism
amyc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amyc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CU254_19835
Enzymes [BR:amyc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     CU254_19835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: ATY12451
UniProt: A0A2K8LVR3
LinkDB All DBs
Position
complement(4261459..4263657)
Genome map
AA seq 732 aa AA seqDB search
MAGNRPGAAGSEPKATVRSEAGGTPGDCCGGPSSWTTGDKSALGTAAGTASPVWFTVARG
VVSEVFYPRADVANIQDMQYVITDGKSFVDLERDATDHVVSMPDEKALEYTVTNTAKSGR
YRLTTTYVTDAGRPTLLTRTRFQSLDGGQYQVYLLANPSMAGGAANDTAAWDGTGLTASG
TEELFGAKTTVASALRASAGFVAHDNGYSGAASDCLVDLRAHRTLTNQFDSTNLGNVVQC
GQLPVGQDTTFSVALGYGGDVQAAAAAADGSLASGFDNLEQAYRRGWEGYVGSLKAAPNS
VAGDERQRRAYYVALMALHAAEDKTHRGASVAGLATPWGDVVNGDVLNDGYHRVWGRDLY
QQATGLLAAGDAAQAKRMARFLWSSQWISAPTQGDGTTYPAGAFPRYSPVSGVQGATPQQ
LGCCEQLDQDSDAIILAWMTGLTDAATYARVKVTAEHIRTSGPATTERWEEQYGRSPSSI
AAEVAGLVTAGAIARANGDPAAAQQWESTADTWRAQLDSWTRTSTGYWGGHTYFERIDKG
TDPNDTGQICFDEGCFYEHDVVDFGFLDLVRLGVRGPADAEVAESVAPTAAARDGNAPMQ
VTAPNGDIYFHRYPHDNYGESTTACTGWPANGPQRFGRLWPVLSGERGEYELANGRSAAV
YLKSMADAANDGYFIPEQVWDRADVACFGLGRPTGSAAPLMWAEGQYLRLAQNMDAGKNL
ETPEVVRQRYGG
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atggcgggaaacaggcccggagcggcggggagcgaacccaaggcgacggtgcggtccgag
gccggaggcacgccgggagattgctgtggcgggccgtcatcttggacaaccggggacaaa
tccgccctcgggacggcggcggggaccgcgagcccggtgtggttcaccgtcgcgcgaggg
gtcgtgtcggaggtgttctatccgcgcgcggacgtggccaacattcaggacatgcagtac
gtgatcaccgacgggaagtcctttgtggaccttgagcgcgacgcgacggaccatgtcgtt
tcgatgccggacgagaaggcgctcgaatacaccgtcacgaataccgccaagagcgggcgt
tatcgcctcacgacgacgtacgttaccgacgcaggaaggccgactctccttacgcgcacg
cggtttcagtcgctcgacggtggacagtatcaggtgtacctgttggcgaatccgtcgatg
gccggtggcgcggcgaacgacaccgcggcatgggacgggactgggctgacggccagcggc
acggaggagttgttcggggccaaaaccactgtggcgtcggcattgcgggcctccgccggg
ttcgtcgcgcacgacaacggatattccggcgccgccagcgattgcctggtagacttgcgg
gcacatcgcactctgacgaatcaattcgattccaccaatcttggcaatgtagtccaatgt
ggacagctccccgtcgggcaggacacgacgttctcggtcgcgctcgggtacgggggcgac
gtccaagcagcggcggcagcggcggacgggtcgctggcgagcgggttcgacaatctggaa
caggcgtatcgacgcggttgggaggggtatgtcggcagcctgaaggcggccccgaacagt
gtggcgggcgacgagcggcagcgcagggcgtattacgtcgcgctgatggcgttgcacgcg
gcggaggacaaaacgcaccgcggcgcgagtgtcgcggggctggccaccccgtggggcgac
gtcgtgaacggcgacgtgctcaacgacgggtaccaccgcgtgtggggccgggatctgtac
cagcaggcgaccgggctcctggcggcgggcgacgcggcacaggcgaagcggatggcgcgg
ttcctgtggtcctcgcagtggatttccgcgcccacccagggcgacggaacgacgtatccg
gcgggggcctttccccggtacagcccggtgagcggggtccagggggccacgccgcagcag
ctcggctgttgcgagcagctcgaccaggattccgacgcgatcatcctcgcctggatgacg
gggctcaccgacgcggcgacgtacgcgcgggtcaaagtgacggcggagcacatccgcacg
agcgggcccgcgacgacggagcggtgggaggagcagtacgggcggtcgccgtcgtcgatc
gcggcggaggtggcggggctggtcacggcgggagcgatcgcgcgggcgaacggcgacccg
gcggcggcgcagcagtgggagtctactgcggacacgtggcgcgcgcagctcgacagctgg
acgcggacgagcaccggctattggggcggccacacctacttcgagcggatcgacaaggga
accgacccgaacgacaccgggcagatctgcttcgacgagggctgcttctacgagcacgac
gtcgtcgacttcgggttcctcgacctcgtccggctcggggttcgcggacctgcggacgcc
gaggtcgccgagtcggtggccccgacggcggcggcccgtgacggcaacgcgccgatgcag
gtgacggctccgaacggcgacatctacttccaccgctacccgcacgacaactacggcgag
agcaccacggcctgcaccggctggccggcgaacgggccgcagcggttcgggcggctctgg
cccgtgctgtcgggcgagcgcggcgagtacgagctggccaacgggcgttcggcggcggtg
tacctgaagtcgatggcggacgcggcgaacgacggctacttcattcccgagcaggtgtgg
gatcgcgccgacgtcgcgtgcttcgggctgggccgtccgaccgggagcgcggcgccgttg
atgtgggcggaaggccagtacctccggctcgcgcagaacatggacgcggggaagaacctg
gagactccggaggtggtccgccagcgctacggcggctga

DBGET integrated database retrieval system