KEGG   Amycolatopsis sp. AA4: CU254_31145Help
Entry
CU254_31145       CDS       T05278                                 

Definition
(GenBank) cystathionine gamma-synthase
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
amyc  Amycolatopsis sp. AA4
Pathway
amyc00270  Cysteine and methionine metabolism
amyc00450  Selenocompound metabolism
amyc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amyc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CU254_31145
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CU254_31145
Enzymes [BR:amyc01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     CU254_31145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP DegT_DnrJ_EryC1 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ATY14381
UniProt: A0A2K8M194
LinkDB All DBs
Position
complement(6761647..6762759)
Genome map
AA seq 370 aa AA seqDB search
MTSALRTRAVHAGRDDLADLGLHAAPLDFSTTYPARDSAEEARRIDEFAAGGNVTGIYGR
IGNPTVERFEQALAELEGFDHAVAFASGMAAVSACLLSAVSQGKRHIVGVRPLYGCTDHL
LITGLLGTEVTWTAPEDVADALRPDTGLVFVETPANPTLSELDIAALTAACGDVPVLVDN
TFATPVLQRPGHLGARMVLHSATKFLGGHGDVMGGIVACDAEEAARLRSLRFATGGVLHP
LAGYLLLRGLSTLPLRVKAASETAAVLASRLASHPSVSAVHYPKLGGPLVAFEVTGDPHA
VVGAVRLITPAVSLGSVDTLIQHPASLTHRIVAEDDRTGSGITHGLLRLSAGLEDVEDLW
LDLDQALKSC
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgacttccgccttgcgcacccgagccgtccacgccggtcgcgacgatctcgccgacctc
ggcctgcacgccgccccgctcgacttctccacgacctaccccgcgcgcgacagcgccgag
gaggcccgccggatcgacgagttcgccgcgggcgggaacgtcaccggcatctacggccgg
atcggcaacccgaccgtcgaacggttcgagcaggcgctcgcggaactcgagggcttcgac
cacgcggtggcgttcgcgagcggcatggcggcggtctcggcgtgcctgctttccgcggtg
tcgcaaggaaaacggcacatcgtcggcgtccggccgctgtacggctgcaccgatcacctg
ctgatcaccggactcctgggcaccgaggtcacctggaccgcgcccgaggacgtcgccgac
gccctgcgcccggacaccggcctcgttttcgtggagacgcccgcgaacccgaccctgagc
gaactggacatcgccgccctgaccgccgcgtgcggcgacgtcccggtcctggtcgacaac
accttcgcgacgccggtcctgcaacgccccggccacctcggcgcccgcatggtgctgcac
agcgcgacgaagttcctgggcggtcacggcgacgtcatgggcggcatcgtggcctgtgac
gccgaagaagccgcgcgtctgcgttctctgcgcttcgcgaccggcggcgtgctgcacccg
ctcgccggatacctgttgctgcgcggcctttcgacgctcccgctgcgcgtgaaggccgcc
tcggaaaccgctgccgtcctggcttcgcggctggcttcgcacccgtcggtcagcgccgtg
cactacccgaagctgggcggccccttggtggccttcgaagtaaccggcgacccgcacgcg
gtcgtcggcgcggtccggctgatcacgcccgcggtgagtctgggcagtgtcgacaccttg
atccagcacccggcgtcgctgacgcaccggatcgtcgctgaggacgaccgcaccggctcc
ggcatcacgcacggcctgctgcggctttcggcggggctggaggacgtcgaggacctgtgg
cttgacctggatcaggcgctgaagtcctgctga

DBGET integrated database retrieval system