KEGG   Amycolatopsis sp. AA4: CU254_36915Help
Entry
CU254_36915       CDS       T05278                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
amyc  Amycolatopsis sp. AA4
Pathway
amyc00250  Alanine, aspartate and glutamate metabolism
amyc00410  beta-Alanine metabolism
amyc00430  Taurine and hypotaurine metabolism
amyc00650  Butanoate metabolism
amyc01100  Metabolic pathways
amyc01110  Biosynthesis of secondary metabolites
amyc01120  Microbial metabolism in diverse environments
amyc02024  Quorum sensing
Module
amyc_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:amyc00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    CU254_36915
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CU254_36915
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CU254_36915
   00430 Taurine and hypotaurine metabolism
    CU254_36915
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    CU254_36915
Enzymes [BR:amyc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CU254_36915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ATY15357
UniProt: A0A2K8M3Y2
LinkDB All DBs
Position
complement(7974245..7975636)
Genome map
AA seq 463 aa AA seqDB search
MVLHQGKQDRADRKTGTNPLYAGSNPALAANFTMPRDRLRDDSLPPDTALQLVRDELMLD
GNARLNLATFVTTWMEPQARELMAECVDKNMIDKDEYPQTAELERRCVNILADLWHAPDP
ANIMGCSTTGSSEACMLAGMALKRRWAKLGRSGKPNLVMGINVQVCWEKFCEYWEVEPRL
VPMEGDRYHLSAEEAVKLCDENTIGVVAILGSTFDGSYEPVAEIAAALDALQERTGWDIP
VHVDGASGAMIAPFLDEDLEWDFRLPRVASINTSGHKYGLVYPGVGWVVWRDKAALPEEL
VFNVNYLGGDMPTFALNFSRPGSEVAAQYYTFVRLGREGFRVVQQASRDVATYLADEISK
LEPFELLTRGDQLPVFAFTTRSDVSSFDVFDVSRRLRERGWLVPAYTFPDNRTDLAVLRI
VVRNGFTHDLADLLLADLKRILPELNRQPSPQHDPATSTAFHH
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgcatcaggggaaacaagatcgggcagaccggaagaccggcacgaatccgttg
tacgcggggagcaatccggcgctcgccgcgaacttcacgatgccgcgcgaccggctgcgg
gacgattcgctgccgccggacacggcactgcagctggtgcgcgacgagctgatgctcgac
ggcaacgcgcggctcaacctcgccacgttcgtcacgacgtggatggagccgcaggcgcgc
gagctgatggccgaatgcgtcgacaagaacatgatcgacaaggacgagtacccgcagacc
gcggaactcgagcggcgctgcgtcaacatcctcgccgatctgtggcacgccccggatccc
gcgaacatcatgggctgctcgaccaccggctcgtccgaggcctgcatgctcgccggcatg
gcgttgaagcggcgctgggcgaagctgggccgcagcgggaagccgaacctggtgatgggc
atcaacgtccaggtctgctgggaaaaattctgcgaatactgggaagtcgaaccgcgcctg
gtgccgatggagggcgaccggtaccacctgtccgcggaagaagcggtgaagctctgcgac
gagaacaccatcggcgtcgtcgcgatcctcggttcgaccttcgacggcagctacgagccg
gtcgccgagatcgcggccgccctcgacgcgctgcaggagcggaccggctgggacatcccg
gtgcacgtcgacggcgcgtccggcgcgatgatcgccccgttcctcgacgaggacctggaa
tgggacttccggctgccgcgcgtcgcgtcgatcaacacctccgggcacaaatacggcctc
gtgtaccccggcgtcggctgggtggtctggcgcgacaaggcggcgctgccggaagagctg
gtgttcaacgtcaactacctcggcggcgacatgccgaccttcgcgctcaacttctcccgc
cccggctcggaagtcgccgcgcagtactacaccttcgtccggctgggccgcgaaggtttc
cgggtggtgcaacaagcttcgcgcgacgtggcgacgtacttggccgacgagatctccaag
ctggagccgttcgagttgctcacccgcggcgaccagctgccggtattcgccttcaccacc
cggtcggacgtcagttcgttcgatgtcttcgacgtgtcccgccgcctccgcgaacgcggc
tggctcgtgcccgcgtacacgttcccggacaaccgcaccgacctggcagtgctgcgcatc
gtcgtccgcaacgggttcacgcacgacctggccgacctgctgctcgccgacctgaagcgg
atcctgccggagctgaaccgccagccctccccgcaacacgacccggccacatcgacggca
ttccaccactaa

DBGET integrated database retrieval system