KEGG   Amycolatopsis sp. AA4: CU254_40230Help
Entry
CU254_40230       CDS       T05278                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
amyc  Amycolatopsis sp. AA4
Pathway
amyc00250  Alanine, aspartate and glutamate metabolism
amyc00410  beta-Alanine metabolism
amyc00640  Propanoate metabolism
amyc00650  Butanoate metabolism
amyc01100  Metabolic pathways
amyc01120  Microbial metabolism in diverse environments
Module
amyc_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:amyc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CU254_40230
   00650 Butanoate metabolism
    CU254_40230
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CU254_40230
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CU254_40230
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:amyc01007]
    CU254_40230
Enzymes [BR:amyc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CU254_40230
Amino acid related enzymes [BR:amyc01007]
 Aminotransferase (transaminase)
  Class III
   CU254_40230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ATY15923
UniProt: A0A2K8MBR7
LinkDB All DBs
Position
complement(8662157..8663437)
Genome map
AA seq 426 aa AA seqDB search
MTDDLLARHRAVLPSWMSLLYDEPIEIVHAQDRRLTDSTGRTYLDFFAGVLTNAMGYDVP
AISDAVRKQLDTGVLHTSTLYLIRSQVELAERIAERSGIPDAKVFFTNSGSEANDTALML
ATQYRRSNQVLAMRNSYHGRSFGTVAITGNRGWSASSLSPVKVNYVHGGYRYRSPFRDLP
DAAYVDACVADLVELLETATAGDVACLIAEPIQGVGGFSSPPDGLFKAMKEVLDEHGILF
VSDEVQTGWGRTGDHYWGIQAHDVVPDMMTFAKGLGNGLAVGGVVARGEIMDCFKAESFS
TFGGNPVSMQGALAVLDYIDDHDLQANCKARGDQLLRGLRAANSPYVGEVRGKGLMIGVE
LVEPGTTTPNTVAAKQMLEETKKRGLLIGKGGLHKNVLRIGPPMTLTEAEADEGLQILLD
SLAALS
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgacctgctcgcgcgccaccgcgcggtgctcccgtcctggatgtccctgctg
tacgacgagccgatcgaaatcgtgcacgcgcaggatcgccggctcaccgattccaccggc
cgcacctacctcgacttcttcgccggcgtgctcaccaacgcgatgggctacgacgtcccc
gcgatcagcgacgcggtccgcaagcagttggacaccggcgtcctgcacacctcgaccctg
tacctgatccgctcccaggtggaactggccgaacggatcgcggaacgctccggcatcccg
gacgcgaaggtgttcttcaccaactccggcagcgaggccaacgacaccgcgctgatgctc
gccacccagtaccgccgcagcaaccaggtgctggcgatgcggaactcgtaccacggccgg
tcgttcggcacggtcgcgatcaccggcaaccgcggctggtccgcgtcgtcgctgagcccg
gtcaaggtcaactacgtccacggcggctaccgctaccgcagccccttccgcgacctcccc
gacgcggcttacgtcgacgcctgcgtcgccgacctggtggaactcctggaaaccgccacc
gcgggcgacgtcgcctgcctgatcgccgagccgatccagggcgtcggcggcttcagttcc
ccgccggacgggctgttcaaggcgatgaaggaggtactggacgagcacggcatcctgttc
gtctccgacgaggtccagaccggctggggccgcaccggcgaccactactggggcatccag
gcgcacgacgtggtgccggacatgatgaccttcgccaagggcctcgggaacggcctggcg
gtcggcggcgtggtcgcccgcggcgagatcatggactgtttcaaagccgagtcgttctcc
accttcggcggcaatccggtgtccatgcagggcgcgctggccgtcctggactacatcgac
gaccacgacctgcaagcgaactgcaaggcccgcggcgaccagttgctgcgcggcctgcga
gcggcgaacagcccgtacgtcggcgaagtccgcggcaagggcttgatgatcggcgtcgag
ctggtcgaacccggcacgacgacgccgaataccgttgccgccaagcaaatgctggaagaa
acgaaaaagcgcggtctgctcatcggaaagggcggtctgcacaaaaacgtcctgcggatc
gggccgccgatgacgctcaccgaagccgaagccgacgagggcctgcagatcctgctcgac
tcgctggccgcgctgtcctga

DBGET integrated database retrieval system