KEGG   Amycolatopsis sp. YIM 10: YIM_05970
Entry
YIM_05970         CDS       T06270                                 

Gene name
davT1
Definition
(GenBank) 5-aminovalerate aminotransferase DavT
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
amyy  Amycolatopsis sp. YIM 10
Pathway
amyy00250  Alanine, aspartate and glutamate metabolism
amyy00410  beta-Alanine metabolism
amyy00640  Propanoate metabolism
amyy00650  Butanoate metabolism
amyy01100  Metabolic pathways
amyy01120  Microbial metabolism in diverse environments
Module
amyy_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:amyy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    YIM_05970 (davT1)
   00650 Butanoate metabolism
    YIM_05970 (davT1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YIM_05970 (davT1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    YIM_05970 (davT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:amyy01007]
    YIM_05970 (davT1)
Enzymes [BR:amyy01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     YIM_05970 (davT1)
Amino acid related enzymes [BR:amyy01007]
 Aminotransferase (transaminase)
  Class III
   YIM_05970 (davT1)
SSDB
Motif
Pfam: Aminotran_3 Aminotran_1_2
Other DBs
NCBI-ProteinID: QFU86412
UniProt: A0A5P9PE93
LinkDB
Position
complement(1205421..1206677)
AA seq 418 aa
MAQLSPLLKQATPVVVDHGEGTYLFDSEGRRHLDFTAGIGVTSTGHCHPRVVAAAQEQIG
KLIHGQYTTVMHKPLLELTERLGGVLPSGLDSLFFSNSGSEAVEAALRLSRQATGRPNVI
VFQGGFHGRTVAAASMTTSGTRFSAGFSPLMSGVHVAPFPYAYHYGWDERTATKFALREL
DYLFATVTAPNEVAAFFVEPVLGEGGYVPANTEFLAGLRERADKHGILLVLDEVQTGFGR
TGKFWGHDHFDVRPDVVLIAKGLASGFPLSGIAASQELMAKAWPGSQGGTYGGNAVSCAA
ACATLDVIKEEGLVANAAERGTQLLDGARLIGDKNAAIGDVRGLGLLVGSEFTTADGEPD
TVTAQAAQKAAAERGLLLLTCGAYMNVVRMIPPLVVTAEQVDEALGIWAEVVDTVTKN
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggcccagctctcccccctgctcaagcaggccaccccggtcgtcgttgaccacggcgag
ggcacctatctgttcgacagcgaaggcaggcggcacctggacttcaccgccggtatcggc
gtcaccagcaccggccactgccaccccagggtggtcgccgccgcccaggagcagatcggc
aagctgatccacgggcagtacaccaccgtgatgcacaagccgctgctcgaactgaccgag
cgcctcggcggcgtgctgccgtccggactggactcgctgttcttctccaactccggcagc
gaagcggtcgaagcggcactgcggctgtcccggcaggcgaccggcaggccgaacgtgatc
gtgttccaaggcgggttccacggccggaccgtcgccgccgcgtcgatgaccacctcgggc
acccggttcagcgcgggcttctcgccgctgatgtccggcgtgcacgtggccccgttcccc
tacgcctaccactacggctgggacgagaggaccgcgacgaagttcgcgctgcgggaactg
gactacctgttcgccacggtcaccgcgccgaacgaggtcgccgccttcttcgtcgagccg
gtgctcggcgagggcggttacgtgcccgccaacaccgagttcctggccggcctgcgtgag
cgcgccgacaagcacggcatcctcctggtgctcgacgaggtgcagaccggcttcggccgc
accggcaagttctggggccacgaccacttcgacgtgcgtcctgacgtcgtgctgatcgcg
aagggcctggccagcggcttcccgctgtccggcatcgccgcgtcgcaggagctgatggcg
aaggcgtggccgggttcgcagggcggcacctacggcggcaacgcggtttcgtgcgccgcc
gcgtgcgccacgctcgacgtgatcaaggaagagggactcgtcgccaacgccgccgagcgc
ggcacgcagctgctcgacggcgctcgcctgatcggcgacaagaacgccgcgatcggggac
gtgcgcgggctcgggctgctggtcggctcggagttcaccaccgcagacggcgagccggac
acggtcaccgcgcaggccgcgcagaaggccgccgccgaacgcgggctgctgctgctcacc
tgcggcgcctacatgaacgtggtgcggatgatcccgccgctggtggtcaccgccgagcag
gtcgacgaggcgctgggcatctgggccgaggtcgtcgacaccgtcaccaagaactga

DBGET integrated database retrieval system