KEGG   Amycolatopsis sp. YIM 10: YIM_39200
Entry
YIM_39200         CDS       T06270                                 

Gene name
cefE2
Definition
(GenBank) Deacetoxycephalosporin C synthase
  KO
K12744  deacetoxycephalosporin-C synthase [EC:1.14.20.1]
Organism
amyy  Amycolatopsis sp. YIM 10
Pathway
amyy00311  Penicillin and cephalosporin biosynthesis
amyy01100  Metabolic pathways
amyy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amyy00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    YIM_39200 (cefE2)
Enzymes [BR:amyy01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.20  With 2-oxoglutarate as one donor, and the other dehydrogenated
    1.14.20.1  deacetoxycephalosporin-C synthase
     YIM_39200 (cefE2)
SSDB
Motif
Pfam: 2OG-FeII_Oxy DIOX_N PSD2
Other DBs
NCBI-ProteinID: QFU92992
UniProt: A0A5P9PXV7
LinkDB
Position
8263714..8264655
AA seq 313 aa
MTDTTVPTFDLTELRAGLHQEEFRRALSEKGVFYLEGSGLDEADHAPAREVAVDFFDHGT
EAEKRAVMTPIPTIRRGYAGLESESTAQITNTGKYTDYSMSYSMGTADNLFPTPEFEQAW
EDYFARMYRASQEVARQVLTTAGAEPVEGMDAFLDCEPLLRLRYFPEVPEDRVAEEQPLR
MAPHYDLSIVTLIHQTPCANGFVSLQVEVGGSYVDIPARPGAVLVFCGAVATLVADGRIK
APKHHVAAPGADKRVGSSRTSSVFFLRPNGDFSFSVPRARECGFDVSIPAETATFNDWIG
GNYINIRKTAAAR
NT seq 942 nt   +upstreamnt  +downstreamnt
atgacggacacgaccgtgcccaccttcgatctgaccgagttgcgcgcggggctgcaccag
gaggagttccgccgcgcgctgagcgagaagggcgtgttctacctcgagggcagcgggctc
gacgaagccgaccacgccccggcgcgtgaggtcgcggtcgacttcttcgaccacggcacc
gaggccgagaagagggccgtgatgacgccgatcccgaccatccggcgaggttacgccgga
ctggagtcggagagcaccgcgcagatcacgaacaccggcaagtacaccgactactcgatg
tcgtactcgatgggcacggcggacaacctgttccccacgccggagttcgagcaggcgtgg
gaggactacttcgcgcggatgtaccgggcttcgcaggaggtcgcgcggcaggtgctgacc
acggcgggcgccgagccggtcgagggcatggacgccttcctcgactgcgaaccgctgttg
cggctgcggtacttccccgaggtgccggaggaccgcgtcgccgaggagcagccgctccgg
atggccccgcactacgacctgtcgatcgtcaccctgatccaccagaccccgtgcgcgaac
ggcttcgtcagcctgcaggtcgaggtcggcgggtcctatgtggacattccggcgcgaccg
ggcgcggtgctggtgttctgcggcgcggtggccaccctggtggccgacggccggatcaag
gcgcccaagcaccacgtggccgcgcccggcgcggacaagcgggtcggcagcagccgcacc
tccagcgtgttcttcctgcgtcccaacggcgacttcagcttctccgtgccgagggcgagg
gagtgcggcttcgacgtcagcatccccgccgagaccgccactttcaacgactggatcggt
ggcaactacatcaacatccggaagaccgccgccgcaaggtga

DBGET integrated database retrieval system