KEGG   Amycolatopsis mediterranei RB: B737_0617Help
Entry
B737_0617         CDS       T02804                                 

Gene name
rifB
Definition
(GenBank) rifamycin polyketide synthase
  KO
K15671  rifamycin polyketide synthase modules 4, 5 and 6
Organism
amz  Amycolatopsis mediterranei RB
Pathway
amz01051  Biosynthesis of ansamycins
amz01052  Type I polyketide structures
Brite
KEGG Orthology (KO) [BR:amz00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01052 Type I polyketide structures
    B737_0617 (rifB)
   01051 Biosynthesis of ansamycins
    B737_0617 (rifB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:amz01008]
    B737_0617 (rifB)
Polyketide biosynthesis proteins [BR:amz01008]
 Polyketide synthase (PKS)
  Modular type I PKS
   cis-AT PKS
    Rifamycin PKS
     B737_0617 (rifB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Acyl_transf_1 KR PS-DH Ketoacyl-synt_C PP-binding KAsynt_C_assoc adh_short Thiolase_N Epimerase Polysacc_synt_2 Sacchrp_dh_NADP GDP_Man_Dehyd PikAIV_N Shikimate_DH RmlD_sub_bind ACP_syn_III Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: AGT81281
LinkDB All DBs
Position
652322..667504
Genome map
AA seq 5060 aa AA seqDB search
MSAPNEQIVDALRASLKENVRLQQENSALAAAAAEPVAIVSMACRYAGGIRGPEDFWRVV
SEGADVYTGFPEDRGWDVEGLYHPDPDNPGTTYVREGAFLQDAAQFDAGFFGISPREALA
MDPQQRQLLEVSWETLERAGIDPHSVRGSDIGVYAGVVHQDYAPDLSGFEGFMSLERALG
TAGGVASGRVAYTLGLEGPAVTVDTMCSSSLVAIHLAAQALRRGECSMALAGGSTVMATP
GGFVGFARQRALAFDGRCKSYAAAADGSGWAEGVGVLLLERLSVARERGHQVLAVIRGSA
VNQDGASNGLTAPNGPAQQRVIRKALASAGLTPSDVDTVEGHGTGTVLGDPIEVQALLAT
YGQGRDPQQPLWLGSVKSVVGHTQAASGVAGVIKMVQSLRHGQLPATQHVDAPTPQVDWS
AGAIELLAEGREWPRNGHPRRGGISSFGASGTNAHMILEEAPEDEPVTEAPAPTGVVPLV
VSAATAASLAAQAGRLAEVGDVSLADVAGTLVSGRAMLSERAVVVAGSHEEAVTGLRALA
RGESAPGLLSGRGSGVPGKVVWVFPGQGTQWAGMGRELLDSSEVFAARIAECETALGRWV
DWSLTDVLRGEADLLDRVDVVQPASFAVMVGLAAVWASLGVEPEAVVGHSQGEIAAACVS
GALSLEDAAKVVALRSQAIAASLAGRGGMASVALSEEDATARLEPWAGRVEVAAVNGPTS
VVIAGDAEALDEALDALDDQGVRIRRVAVDYASHTRHVEAARDALAEMLGGIRAQAPEVP
FYSTVTGGWVEDAGVLDGGYWYRNLRRQVRFGPAVAELIEQGHRVFVEVSAHPVLVQPIN
ELVDDTEAVVTGTLRREDGGLRRLLASAAELFVRGVTVDWSGVLPPSRRVELPTYAFDHQ
HYWLQMGGSATDAVSLGLAGADHPLLGAVVPLPQSDGLVFTSRLSLKSHPWLAGHAIGGV
VLIPGTVYVDLALRAGDELGFGVLEELVIEAPLVLGERGGVRVQVAVSGPNETGSRAVDV
FSMREDGDEWTRHATGLLGASTSREPSRFDFAAWPPAGAEPIDVENFYTDLTERGYAYSG
AFQGMRAVWRRGDEVFAEVALPDDHREDAGKFGLHPALLDAALHTNAFANPDDDRSVLPF
AWNGLVLHAVGASALRVRVAPGGPDALTFQAADETGGLVVTMDSLVSREVSAAQLETAAG
EERDSLFQVDWIEVPATETAATEHAEVLEAFGEAAPLELTSRVLEAVQSWLADAADEARL
VVVTRGAVREVTDPAGAAVWGLVRAAQAENPGRIILVDTDGDVPLGAVLASGEPQLAVRG
NAFSVPRLARATGEVPEAPAVFSPEGTVLLTGGTGSLGGLVAKHLVARHGVRRLVLASRR
GVAAEDLVTELTEQGATVSVVACDVSDRDQVAALLAEHRPTGIVHLAGLLDDGVIGALNR
ERLAGVFAPKVDAVQHLDELTRDLGLDAFVVFSSAAALMGSAGQGNYAAANAFLDGLMAG
RRAAGLPGVSLAWGLWEQADGLTANLSATDQARMSRGGVLPMTPAEALDIFDIGLAAEQA
LLVPIKLDLRTLRGQATAGGEVPHLLRGLVRASRRVTRTAAASGGGGLVHKLAGRPAEEQ
EAVLLGIVQAEAAAVLGFNAPELAQGTRGFSDLGFDSLTAVELRNRLSAATGVKLPATLV
FDYPTPVALARHLREELGETVAGAPATPVTTVADAGEPIAIVGMACRLPGGVMSPDDLWR
MVAEGRDGMSPFPGDRGWDLDGLFDSDPERPGTAYIRQGGFLHEAALFDPGFFGISPREA
LAMDPQQRLLLEASWEALERAGIDPTKARGDAVGVFSGVSIHDYLESLSNMPAELEGFVT
TATAGSVASGRVSYTFGFEGPAVTVDTACSSSLVAIHLAAQALRQGECTMALAGGVAVMG
SPIGVIGMSRQRGMAEDGRVKAFADGADGTVLSEGVGIVVLERLSVARERGHRVLAVLRG
SAVNQDGASNGLTAPNGPSQQRVIRSALAGAGLQPSEVDVVEAHGTGTALGDPIEAQALL
ATYGKSRETPLWLGSLKSNIGHTQAAAGVAAVIKMVQALRHDTLPPTLHVQEPTKQVDWS
AGAVELLTEGREWARNGHPRRAGVSSFGISGTNAHLILEEAPADDTAEADVPDAVVPVVI
SARSTGSLAGQAGRLAAFLDGDVPLTRVAGALLSTRATLTDRAVVVAGSAEEARAGLTAL
ARGESASGLVTGTAGMPGKTVWVFPGQGTQWAGMGRELLEASPVFAERIEECAAALQPWI
DWSLLDVLRGEGELDRVDVLQPACFAVMVGLAAVWASVGVVPDAVLGHSQGEIAAACVSG
ALSLEDAAKVVALRSQAIAAELSGRGGMASIQLSHDEVAARLAPWAGRVEIAAVNGPASV
VIAGDAEALTEAVEVLGGRRVAVDYASHTRHVEDIQDTLAETLAGIDAQAPVVPFYSTVA
GEWITDAGVVDGGYWYRNLRNQVGFGPAVAELIEQGHGVFVEVSAHPVLVQPISELTDAV
VTGTLRRDDGGVRRLLTSMAELFVRGVPVDWATMAPPARVELPTYAFDHQHFWLSPPAVA
DAPALGLAGADHPLLGAVLPLPQSDGLVFTSRLSVRTHPWLADGVPAAALVELAVRAGDE
AGCPVLADLTVEKLLVLPESGGLRVQVIVSGERTVEVYSQLEGAEDWIRNATGHLSATAP
AHEAFDFTAWPPAGAQQVDGLWRRGDEIFAEVALPEELDAGAFGIHPFLLDAAVQPVLAD
DEQPAEWRSLVLHAAGASALRVRLVPGGALQAADETGGLVLTADSVAGRELSAGKTRAGS
LYRVDWTEVSIADSAVPANIEVVEAFGEEPLELTGRVLEAVQTWLVTAADDARLVVVTRG
AVREVTDPAGAAVWGLVRAAQAENPGRIFLIDTDGEIPALTGDEPEIAVRGGKFFVPRIT
RAEPSGAAVFRPDGTVLISGAGALGGLVARRLVERHGVRKLVLASRRGRDADGVADLVAD
LAADVSVVACDVSDRAQVAALLDEHRPTAVVHTAGVIDAGVIETLDRDRLATVFAPKVDA
VRHLDELTRDRDLDAFVVYSSVSAVFMGAGSGSYAAANAFLDGLMANRRAAGLPGLSLAW
GLWDQSTGMAAGTDEATRARMSRRGGLQIMTQAEGMDLFDAALSSAESLLVPAKLDLRGV
RADAAAGGVVPHMLRGLVRAGRAQARAASTVDNGLAGRLAGLAPADQLTLLLDLVRAQVA
AVLGHADASAVRVDTAFKDAGFDSLTAVELRNRMRTATGLKLPATLVFDYPNPQALARHL
RDELGGAAQTPVTTAAAKADLDEPIAIVGMACRLPGGVAGPEDLWRLVAEGRDAVSSFPT
DRGWDTDSLYDPDPARPGKTYTRHGGFLHEAGLFDAGFFGISPREAVAMDPQQRLLLEAS
WEAMEDAGVDPLSLKGNDVGVFTGMFGQGYVAPGDSVVTPELEGFAGTGGSSSVASGRVS
YVFGFEGPAVTIDSACSSSLVAMHLAAQSLRQGECSMALAGGATVMANPGAFVEFSRQRG
LAVDGRCKAFAAAADGTGWAEGVGVVILERLSVARERGHRILAVLRGSAVNQDGASNGLT
APNGPSQQRVIRRALVSAGLAPSDVDVVEAHGTGTTLGDPIEAQALLATYGKDRESPLWL
GSLKSNIGHAQAAAGVAGVIKMVQALRHEVLPPTLHVDRPTPEVDWSAGAVELLTEAREW
PRNGRPRRAGVSAFGVSGTNAHLILEEAPAEEPVPTPEVPLVPVVVSARSRASLAGQAGR
LAGFVAGDASLAGVARALVTNRAALTERAVMVVGSREEAVTNLEALARGEDPAAVVTGRA
GSPGKLVWVFPGQGSQWIGMGRELLDSSPVFAERVAECAAALEPWIDWSLLDVLRGESDL
LDRVDVVQPASFAMMVGLAAVWQSVGVRPDAVVGHSQGEIAAACVSGALSLQDAAKVVAL
RSQAIATRLAGRGGMASVALSEEDATAWLAPWADRVQVAAVNSPASVVIAGEAQALDEVV
DALSGQEVRVRRVAVDYGSHTNQVEAIEDLLAETLAGIEAQAPKVPFYSTLIGDWIRDAG
IVDGGYWYRNLRNQVGFGPAVAELVRQGHGVFVEVSAHPVLVQPLSELSDDAVVTGSLRR
EDGGLRRLLTSMAELYVQGVPLDWTAVLPRTGRVDLPKYAFDHRHYWLRPAESATDAASL
GQAAADHPLLGAVVELPQSDGLVFTSRLSVRTHPWLADHAVGGVVILPGSGLAELAVRAG
DEAGCTALDELIIEAPLVVPAQGAVRVQVALSGPDETGSRTVDLYSQRDGGAGTWTRHAT
GVLSTAPAQEPEFDFHAWPPADAERIDVETFYTDLAERGYGYGPAFQGLQAVWRRDGDVF
AEVALPEDLRKDAGRFGVHPALLDAALQAATAVGGDEPGQPVLAFAWNGLVLHAAGASAL
RVRLAPSGPDTLSVAAADETGGLVLTMESLVSRPVSAEQLGAAADAGHDAMFRVDWTELP
AVPRAELPPWVRIDTADDVAALAEKADAPPVVVWEAAGGDPALAVSSRVLEIMQAWLAAP
AFEEARLVVTTRGAVPAGGDHTLTDPAAAAVWGLVRSAQAEHPDRVVLLDTDGEVPLGAV
LASGEPQLAVRGTTFFVPRLARATRLSDAPPAFDPDGTVLVSGAGSLGTLVARHLVTRHG
VRRVVLASRQGRDAEGAQDLITELTGEGADVSFVACDVSDRDQVAALLAGLPDLTGVVHT
AGVFEDGVIEALTPDQLANVYAAKVTAAMHLDELTRDRDLGAFVVFSSVAGVMGGGGQGP
YAAANAFLDAAMASRQAAGLPGLSLAWGLWERSSGMAAHLSEVDHARASRNGVLELTRAE
GLALFDLGLRMAESLLVPIKLDLAAMRASTVPVLFRGLVRPSRTQARTASTVDRGLAGRL
AGLPVAERAAVLVDLVRGQVAVVLGYDGPEAVRPDTAFKDTGFDSLTSVELRNRLREATG
LKLPATLVFDYPNPLAVARYLGARLVPDGTANGNGNGNGHSEDDRLRHALAAIAAEDAGE
ERSIADLGVDDLVQLAFGDE
NT seq 15183 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcgccgaacgagcagatcgttgacgcactgcgcgcgtcgctgaaggagaacgtc
cggcttcagcaggagaacagcgcgctcgccgcggccgccgcggagcccgtcgcgatcgtc
tccatggcctgccgctacgcgggcgggatccgcggcccggaggacttctggcgggtggtg
tcggaaggcgccgacgtctacaccggcttccccgaggaccgcggctgggacgtcgaaggc
ctctaccacccggaccccgacaaccccggcacgacgtacgtgcgggagggcgccttcctg
caggacgcggcccagttcgacgccgggttcttcggcatctcgccgcgcgaggcgctggcc
atggacccccagcagcggcagctcctggaggtgtcctgggagaccttggaacgggccggc
atcgacccgcattcggtgcggggcagcgacatcggcgtctacgccggggtcgtgcaccag
gactacgcccccgacctcagcgggttcgaaggcttcatgagcctggagcgcgccctgggc
accgcgggcggtgtcgcctccggccgggtcgcctacacgctcgggctcgaaggccccgcc
gtcaccgtcgacacgatgtgctcgtcgtcgctggtggcgattcaccttgccgcgcaagct
cttcgccgtggtgagtgctcgatggccctcgcgggcggctcgaccgtgatggcgaccccg
ggcgggttcgtcggcttcgcgcgtcagcgggcgttggccttcgacgggcgctgcaagtcc
tacgccgcggccgccgacggttccggctgggccgagggcgtcggcgtgctgctgctggag
cggctgtcggtggcgcgcgagcgcgggcaccaggtgctggccgtcatccgcggcagcgcg
gtcaaccaggacggcgcttccaacggcctgaccgcgcccaacggcccggcgcagcagcgg
gtcatccgcaaggcactggcgagcgccgggctgacaccgtccgatgtggacaccgtggag
ggccacggcaccggcaccgtcctcggcgacccgatcgaggtccaggcgctgctggccacc
tacggccagggccgcgacccgcagcaaccgctgtggctgggctcggtcaagtccgtcgtc
gggcacacgcaggcggcatccggtgtggccggcgtgatcaagatggtccagtcgctgcgg
cacgggcagctcccggcgacccagcacgtcgacgcgcccacgccgcaagtggactggtcg
gccggagcgatcgagctgctggccgagggccgggagtggccgcgcaacggccacccgcgc
cggggcggcatctcgtcgttcggggccagcggcacgaacgcgcacatgatcctcgaagaa
gcgcccgaggacgagccggtgaccgaagcgccggcgcccacgggtgtcgtaccgctggtg
gtgtcggcggcgaccgctgcttccctggccgcccaggccggtcggctggcggaggtcggc
gacgtctccctggcggatgtcgccgggacgctggtgtccggccgcgcgatgctcagcgag
cgcgcggtcgtcgtggccggctcccacgaagaagccgtgaccgggctgcgggcgctggcc
cgcggcgagagcgcgcccggcctgctttccggccgcggctcgggggtcccgggcaaggtc
gtctgggtgttccccggccagggcacgcagtgggccggcatgggccgcgagctgctggac
tcctcggaggtgttcgccgcgcggatcgccgagtgcgagaccgcgctcgggcggtgggtc
gactggtcgctgaccgacgtgctgcgcggcgaggccgacctgctggaccgggtcgacgtg
gtgcaaccggcgagcttcgccgtgatggtcgggcttgccgccgtctgggcctccctcggc
gtcgagcccgaggccgtggtgggccactcgcagggcgagatcgcggccgcatgcgtgtcc
ggggcactgtccctggaggacgcggcgaaggtggtggcgttgcgcagccaggcgatcgcc
gcctcgctggccggccggggcggcatggcgtcggtcgcgttgagcgaagaagacgcgacc
gcgcggctcgagccgtgggcgggccgcgtggaggtcgccgccgtcaacgggccgacgtcc
gtggtgatcgccggggacgccgaggcgctggacgaagccctcgacgcgctcgacgaccaa
ggcgtccggatccggcgggtggcggtggactacgcctcccacacccggcacgtcgaagcc
gcgcgcgacgcactggccgagatgctgggcgggatccgcgcgcaggcgccggaagtgccg
ttctactcgaccgtgaccggcggctgggtcgaagacgccggcgtgctcgacggcggctac
tggtaccggaacctccgccgtcaggtgcggttcggcccggcggtggccgagctgatcgag
cagggccaccgggtgttcgtcgaggtcagcgcgcatcccgtgctggttcagccgatcaac
gaactcgtcgacgacaccgaagccgtggtcaccgggacgctgcggcgcgaggacggcggc
ctccggcgcctgctggcctcggcggccgagctcttcgtccgcggcgtgaccgtggactgg
tccggtgtgctgccaccgtcccgccgggtcgagctgccgacgtacgccttcgaccaccag
cactactggctgcagatgggcgggtcggccaccgacgccgtgtcgctgggcctggccggc
gccgaccacccgctgctgggcgcggtcgtcccgctgccgcagtccgacgggctcgtcttc
acctcgcggctgtcgctgaagtcgcacccgtggctggccgggcacgcgatcggcggggtc
gtgctcattccgggcacggtgtacgtcgacctcgcgctgcgcgccggcgacgagctcggc
ttcggcgtcctggaagagctcgtgatcgaggcaccgctggtgctgggcgagcgcggcggc
gttcgcgtgcaggtcgccgtgagcgggccgaacgagaccggctcgcgtgcggtggacgtc
ttctccatgcgggaagacggcgacgaatggacccggcacgcgaccggtctcctcggggcg
tcgacgtcccgggaaccgagccgcttcgacttcgccgcctggccgccggccggggcggag
ccgatcgacgtcgaaaacttctacaccgacctcaccgagcgcgggtacgcctacagcggc
gccttccagggcatgcgggcggtctggcggcgcggtgacgaggtcttcgccgaggtcgcg
ctgcctgacgaccaccgcgaggacgccggcaagttcggcctccaccccgccctcctcgac
gccgctctgcacacgaacgccttcgcgaacccggacgacgaccgcagtgtgctgccgttc
gcgtggaacggcctggtcctgcacgccgtgggcgcgtcggcgctgcgggtgcgggtggcg
ccgggcggtccggacgcgctgacgttccaggccgccgacgagaccggtggcctggtcgtc
accatggattcgctggtgtcccgcgaggtgtcggccgcgcagctggagacggcggcgggc
gaagagcgcgactcgctgttccaggtggactggatcgaggtccccgcgaccgagaccgcg
gccaccgagcacgccgaggtgctcgaagccttcggcgaggcagcgcccctcgagctgacc
agccgggtgctggaggccgtgcagtcctggctcgccgacgcggccgacgaagcacggttg
gtcgtggtgacccgtggcgccgtgcgcgaggtgacggacccggccggtgccgccgtgtgg
ggtttggtgcgagccgcccaggcggagaacccgggccggatcatcctcgtcgacaccgac
ggcgacgtcccgctgggtgcggtgctggccagtggtgagccgcagctcgccgtgcgcggc
aacgctttctccgtcccgcgcctcgcccgggccaccggcgaggtgccggaggcccccgcg
gtgttcagtccggaagggacggtcctgctcaccggcggcaccggctcgctgggcggtctg
gtggccaagcacctggttgcccggcacggcgtccggcggctggtgctcgccagccgccga
ggcgtggccgcggaagacctcgtcaccgagctgaccgagcagggcgcgacggtgtccgtg
gtggcttgcgacgtctccgaccgcgaccaggtggccgcgttgctggccgaacaccgcccg
accggcatcgtgcacctggccggcctgctggacgacggcgtcatcggagccctgaaccgg
gagcggctggccggggtgttcgcgcccaaggtcgatgccgtccagcacctcgacgaactg
acccgcgacctcggcctcgacgcgttcgtcgtgttctcgtccgcagccgcgctcatgggc
tccgccggccagggcaactacgcggccgccaacgccttcctcgacggcttgatggccggg
cgccgcgcggcgggcctgccaggcgtgtccctggcgtggggcctgtgggagcaggcggac
ggcctgaccgcgaacctcagcgccaccgaccaggcccggatgagccgcggcggcgtgctg
ccgatgacaccggccgaggccctggacatcttcgacatcggcctggccgccgagcaggcc
ctgctggtcccgatcaagctcgacctgcggacgctgcgcggccaggccaccgccggcggc
gaggtgccgcacctgctgcgcggcctggtccgcgcgagccgccgcgtgacccgcacggct
gccgcgagtggcggcggtggcctggtccacaagctcgccgggcggccagccgaagagcag
gaagccgtgctgctgggcatcgtccaggcggaggcggccgcggtgctcggcttcaacgcc
cccgagctggcccagggcacccgcgggttcagcgacctcggcttcgactcgctgaccgcg
gtcgagctgcggaaccggctgagcgcggcgaccggcgtcaaattgcccgccacgctcgtc
ttcgactacccgacgccggtcgcgctcgcccgccacctgcgcgaagagctgggcgagacg
gtggcgggtgcgccggccacgccggtgacgaccgtcgccgacgcgggcgagccgatcgcc
atcgtcggcatggcgtgccgcctgccgggcggcgtgatgagccccgacgacctctggcgg
atggtcgccgagggccgcgatgggatgtcgccgttccccggagaccgcggctgggacctg
gacggcctgttcgactcggaccccgagcgcccgggcaccgcctacatccgccaaggcggc
ttcctgcacgaggccgcgctgttcgacccgggcttcttcgggatctcgccgcgcgaagcc
ctggccatggacccgcagcagcggctgctgctcgaagcctcctgggaagccctggagcgc
gcgggcatcgacccgaccaaggcccgcggtgacgccgtcggcgtcttctccggcgtctcc
atccacgactacctcgagtccctgagcaacatgcccgccgagctcgaaggcttcgtcacc
acggccacggcgggcagcgtcgcctcgggccgggtgtcctacaccttcgggttcgagggc
ccggcggtcacggtggacacggcgtgctcgtcgtcgctggtcgcgatccacctggccgca
caggcactgcggcagggcgagtgcacgatggccctggccggcggtgtcgccgtgatgggc
tcgccgatcggtgtcatcggcatgtcgcggcagcgcggcatggccgaggacggccgggtc
aaggcgttcgccgacggcgcggacggcaccgtcctgtccgaaggcgtcggcatcgtcgtc
ctcgaacggctttcggtggcccgcgaacgcgggcaccgggtgctcgccgtgctccgcggc
agcgcggtcaaccaggacggcgcttcgaacggcctgaccgcgcccaacgggccgtcgcag
cagcgggtgatccgcagcgcgctggccggggccggactgcaaccgtccgaagtggacgtc
gtcgaggcgcacggcaccgggaccgcgctgggcgacccgatcgaggcccaggccctgctg
gccacctacggcaagagccgcgagacgccgttgtggctcgggtcgctgaagtcgaacatc
ggccacacccaggcggccgcgggcgtggcggccgtgatcaagatggtccaggcgctgcgg
cacgacaccctgccgccgaccctccacgtgcaggaacccaccaagcaggtggactggtcc
gcgggtgcggtcgagctgctgaccgaaggccgggagtgggcccgcaacggccacccgcgc
cgggccggtgtctcgtcgttcggcatcagcggcaccaacgcgcacctcatcctggaagag
gcgcccgccgacgacaccgccgaggcggacgtgcccgacgccgtggtgcccgtggtgatc
tccgcgcgcagcaccggatccctggcgggccaggccggacgcctggcggcgttcctcgac
ggagacgtcccgctgacccgcgtggcgggtgccctgctgtcgacccgggcgacgctgacc
gaccgggccgtcgtcgtggcgggctcggccgaggaggcccgggcggggctgaccgcgctg
gcccgcggcgagagcgcgagcgggcttgtgaccggtaccgcagggatgccgggcaagacg
gtctgggtgttccccggccaggggacgcagtgggcgggcatgggccgggagctcctcgaa
gcgtccccggtgttcgccgagcgcattgaggaatgcgcggccgcgctgcagccgtggatc
gactggtcgctgctggacgtcctccgtggcgaaggtgagctggatcgggtcgacgtgctg
cagccggcgtgtttcgcggtgatggtggggctggccgccgtctgggcctcggtcggcgtc
gtgccggacgcggtcctgggccactcccagggcgagattgccgccgcctgcgtgtcgggt
gcactgtccctcgaggacgcagccaaggtcgtcgcgctgcgcagccaggcgatcgcggcg
gagctgtcgggccgcgggggcatggcgtcgatccagctgagccacgacgaggtggctgcc
cggctcgcgccgtgggcgggccgcgtcgagatcgccgccgtcaacggtccggcctcggtc
gtgatcgccggtgacgccgaagcgctcaccgaggccgtcgaagtcctcggcggtcggcgg
gtggcggtggactacgcgtcccacacgcggcacgtcgaggacatccaggacaccctcgcc
gagactctggccgggatcgacgcgcaggcccccgtggtgcccttctactccacggtcgcc
ggcgagtggatcaccgatgccggggtcgtcgacggcgggtactggtaccggaacctgcgc
aaccaggtcggcttcggcccggccgtggccgagctgatcgagcaggggcacggggtgttc
gtcgaggtcagtgcgcatccggtgctggtgcagccgatcagcgagctcaccgatgcggtc
gtcaccgggacgttgcggcgcgacgacggtggggtgcggcggctgctgacctcgatggcc
gaactgttcgtccgcggtgtcccggtcgactgggccacgatggcgccgcccgcgcgcgtc
gagctgccgacctacgccttcgaccaccagcacttctggctcagcccgcccgccgtggcg
gacgcgcccgcgctcggcctggccggcgccgaccacccgctgctgggggcggttctcccg
ctgccgcagtccgacggcctggtgttcacctcgcgcctgtcggtgcggacgcatccgtgg
ctggccgacggcgtccccgccgccgccttggtggagctggccgtgcgggccggtgacgaa
gccggttgcccggtcctcgccgacctgaccgtcgaaaagctgctggtgctgccggagagc
ggtggcctgcgcgtccaggtgatcgtgagcggcgagcgcacggtcgaggtgtattcgcag
ctcgaaggcgccgaagactggatccggaacgccaccgggcacctgtccgccacggctccg
gcgcacgaggccttcgacttcaccgcctggccgcccgccggagcccagcaggtcgacggc
ctctggcggcgcggcgacgagatcttcgccgaggtcgccctgccggaggagctggacgcc
ggcgcgttcggcatccaccccttcctgctggacgcggccgtgcagccggtcctcgcggac
gacgagcagccggcggagtggcgcagcctggtcctgcacgccgcgggtgcctcggcgctg
cgcgtgcggctggtgcccggcggtgccctccaagcggcggacgaaaccggcgggctggtc
ctcacggcggattcggtggcaggccgggaactctcggccgggaagacccgcgccggatcg
ctgtaccgggtcgactggaccgaagtgtccattgcagacagtgcggtgccggccaacatc
gaggtcgtcgaagccttcggtgaagagcccctggaactgaccggccgggtcctggaggct
gtgcagacctggctcgtcaccgcggccgacgatgcgcggctggtcgtggtgacccgcggc
gccgtgcgcgaggtgaccgaccccgccggtgcggccgtgtggggcctggtccgagccgcg
caggcggagaaccccggtcgcatcttcctgatcgacaccgacggcgagatcccggccctg
accggtgacgagcccgagatcgcggtgcgcggcgggaagttcttcgtgccccgcatcact
cgcgcggagccgagcggggccgccgtgttccgcccggacgggacagtgctgatctcgggc
gcgggtgcgctcggtggcctggtggcccggcgtctcgtcgaacgccacggcgtgcggaag
ctcgtgctggcgtcccggcgcggccgagacgccgacggcgtggcggacctggtcgccgac
ctggccgcggacgtgtccgtggtggcttgcgacgtctccgatcgcgcccaggtggcggcc
ctgctcgacgagcaccggccgaccgccgtcgtgcacaccgccggcgtcatcgacgcgggc
gtgatcgagacgctggaccgggaccggctggccacggtgttcgcgccgaaggtcgacgcc
gtgcggcacctcgacgagctgacccgcgaccgcgacctcgacgccttcgtcgtctactcc
tcggtctcggccgtgttcatgggcgcgggcagcggcagttacgccgcggcgaacgccttc
ctggacggcctgatggcgaaccgccgggcggcgggcctgccgggcctgtcgctggcgtgg
ggcctgtgggaccagagcaccggtatggccgccggcaccgacgaggccacccgggcgcgg
atgagccgccgcggtggcctgcagatcatgacgcaggccgagggcatggacctgttcgac
gccgcgctgtcgtcggccgagtcgctgctggtgcccgccaagctcgacctgcgtggggtg
cgcgccgacgccgccgcgggcggggtcgtgccgcacatgctgcgtggcctggtccgcgcg
ggccgggcgcaggcccgcgcggcgtccactgtggacaacgggctggccggacggctggcc
gggctcgccccggcggaccagctcacgctgctcctggacctggtccgggcgcaggtcgcg
gccgtgctcgggcacgccgacgcgagcgccgtccgcgtcgacacggccttcaaggacgcc
ggcttcgactcgctgaccgcggtcgagctgcgcaaccgcatgcggaccgccaccggcctg
aagctgcccgcgacgctcgtcttcgactacccgaacccccaggcgctcgcccggcacctg
cgcgacgaactcggtggtgcggcccagacgccggtgaccacagcggccgcgaaggccgac
ctcgacgagccgatcgccatcgtcgggatggcgtgccgcttgccgggcggggtcgccggg
cccgaggacctctggcggctggtcgccgagggccgggacgcggtgtcgagcttcccgacc
gaccgcggctgggacaccgacagcctgtacgatcccgatccggcccgcccgggcaagacc
tacacccggcacggcggcttcctgcacgaagccgggctcttcgacgcgggcttcttcggg
atctcgccacgcgaggccgtcgccatggacccgcagcagcggctgctgctggaggcctcc
tgggaggccatggaagacgccggggtcgacccactttcgctgaagggcaacgacgtcggc
gtgttcaccggcatgttcggccagggttacgtcgctcccggggacagcgtcgtcacgccg
gagctggagggtttcgcgggcacgggcgggtcgtcgagtgtcgcgtccggccgcgtgtcg
tacgtgttcgggttcgaaggcccggccgtgacgatcgactcggcgtgctcgtcctcgctg
gtcgcgatgcacctcgccgcgcagtcgctgcggcagggcgagtgctcgatggccttggcc
ggcggcgcgacggtgatggcgaaccccggcgcattcgtggagttctcgcggcagcggggc
ctcgccgtcgacggtcgctgcaaggcgttcgccgccgcggccgacggcaccggctgggcc
gagggcgtcggtgtggtcatcctcgagcggctgtcggtggcgcgggaacgcggccaccgg
atcctggccgtgctgcgcggcagcgcggtcaaccaggacggcgcctcgaacggcctgacc
gcgccgaacgggccgtcgcagcagcgggtgatccgccgggcgctggtgagcgccgggctg
gcaccgtccgatgtggacgtcgtcgaggcgcacggcaccgggaccacgctgggtgacccg
atcgaggcgcaagctctgctggctacctacggcaaggaccgcgagtcgccgctgtggctc
ggctcgctgaagtcgaacatcggccacgcgcaggccgccgcgggggtcgccggcgtcatc
aagatggtccaggcgctccggcacgaagtcctgccgccgacgctgcacgtcgaccggcct
acccccgaggtcgactggtcggccggtgccgtcgaactgctgacggaagcccgcgagtgg
ccgcgcaacgggcgcccgcgccgggccggggtctccgcgttcggcgtcagcggcacgaac
gcgcacctgatcctggaggaggcgcccgccgaagagccggtgcccacacccgaggttccc
ctggtgccggtcgtggtctccgcgcggagcagggcgtccctggccggtcaggccggtcgc
ctcgccggattcgtggcgggtgacgcgtccttggccggtgtggcccgggcgctggtgacg
aaccgggccgcgctgaccgagcgcgcggtcatggtcgtgggctctcgcgaagaagccgtg
acgaacctggaagcgctggcccgcggcgaagacccggccgcggtggtcaccggccgggcg
ggttcgccgggcaagctcgtctgggtcttccccggccagggctcgcagtggatcgggatg
ggccgggaactcctggactcttcgccggtcttcgccgagcgggtcgccgaatgcgcggcc
gccctggaaccgtggatcgattggtcactgctcgacgtgctgcgcggggagtccgacctg
ctggaccgggtcgacgtcgtgcagcccgccagcttcgcgatgatggtcggcctggccgcg
gtgtggcagtcggtgggtgtccgcccggatgccgtcgtcggccactcgcagggcgagatc
gccgccgcctgcgtctcgggcgcgctgtcgctgcaggacgccgcgaaggtggttgccttg
cgcagccaggcgatcgccacccggctggccgggcgcggcggcatggcttccgtggcgttg
agcgaagaagacgcgaccgcgtggctggcgccgtgggccgaccgggtccaggtggccgcg
gtcaacagccctgcctccgtggtgatcgccggggaagcccaggccctcgacgaggtcgtc
gacgcgttgtccggtcaggaagtccgcgtccggcgggtggccgtggactacgggtcccac
accaaccaggtcgaagccatcgaggatctgctggccgagaccttggccggcatcgaggcg
caggccccgaaggtgcccttctactcgaccctgatcggtgactggatccgtgacgccggg
atcgtcgacggcggctactggtaccggaacctgcgcaaccaggtcgggttcggtccggcc
gtcgcggagctcgttcgccagggccacggggtgttcgtcgaggtcagcgcgcacccggtg
ctggtccagccgctcagtgaactcagcgacgacgcggtggtgaccgggtcgctgcggcgc
gaagacggtggcctgcgccgcctgctgacgtcgatggccgagctgtacgtgcagggtgtc
ccgctcgactggaccgcggtcctgccgcggaccggccgggtcgacctgccgaagtacgcc
ttcgaccaccggcactactggctgcggcccgccgagtccgcgaccgacgcggcttcgctg
ggccaggcggcggccgaccacccgctgctgggcgcggtcgtcgagctgccgcagtccgac
ggcctggtgttcacctcgcggctgtccgtgcggacgcacccgtggctggccgaccacgcg
gtcggtggcgtggtcatcctccccggctccgggctggccgaactggccgtccgggccggc
gacgaagccgggtgcaccgccctcgacgagctgatcatcgaagctccgctggtcgtgccc
gcccaaggcgcggtccgcgtccaggtcgcgttgagcggcccggacgagaccggctcgcgc
acggtggacctctactcccagcgcgacggcggcgcggggacgtggacgcggcacgccacc
ggcgtgctgtcgacggcccccgctcaggaacccgagttcgacttccacgcctggccgccc
gcggatgccgagcggatcgacgtcgagaccttctacaccgacctggccgagcgtggttac
ggctacgggccggcgttccaggggctgcaagcggtgtggcggcgtgacggcgacgtcttc
gccgaggtcgccctgcccgaggacctgcgcaaggacgcgggccggttcggcgtccacccg
gcgctgctcgacgcggcgctgcaggccgccacggccgtgggcggcgacgagcccggtcag
ccggtgctggcgttcgcgtggaacggcctggtcctgcacgccgcgggcgcgtcggccctg
cgggtccggctcgcgccgagcggcccggacacgctgtccgtggcagccgccgacgaaacc
ggcggcttggtcctgaccatggaatcgctggtctcccggccggtttcggccgagcagctc
ggcgccgcggccgacgcgggccacgacgcgatgttccgcgtcgactggaccgagctgcct
gccgtgccccgcgcggaactgccgccgtgggtgcggatcgacaccgccgacgacgtcgcg
gccttggcggagaaggcggacgcaccaccggtggtggtctgggaagccgccgggggagac
ccggccctggccgtgagttcccgggtgctcgagatcatgcaggcctggctggccgcgccc
gcgttcgaggaggcccggctggtcgtgacgacccgcggcgcggtacccgccggcggtgac
cacacactgaccgacccggccgcggccgcggtgtggggcctggtccggtccgcgcaggcg
gaacacccggaccgggtcgtcctgctggacaccgacggcgaagttccgctgggcgcggtg
ctggcctccggtgagccgcagctcgcggtgcgcggaacgacgttcttcgtgccccggctg
gcccgcgccacccggctctcggacgcgcctcctgcgttcgacccggacgggaccgtgctg
gtctcgggcgccggatcgctgggcaccttggtggcccggcacctggtcacccggcacggc
gtgcgccgggtggtgctggccagccggcagggccgggacgccgagggcgcccaggacctg
atcaccgagctcaccggcgaaggcgcggacgtgtccttcgtggcctgtgacgtctccgat
cgcgaccaggtggccgcgctgctcgcgggcctcccggacctgaccggggtggtgcacacc
gccggcgtcttcgaggacggcgtgatcgaggcgctgacgcccgaccagctcgcgaacgtg
tacgcggccaaggtcacggccgcgatgcacctcgacgagctcacccgcgaccgggatctc
ggcgcgttcgtcgtgttctcctccgtcgcgggggtgatgggtggtggcggtcaaggcccg
tacgcggcggcgaacgccttcctggacgcggcgatggcgagtcgtcaggccgcgggcctg
ccgggcctgtccctggcgtggggcctctgggaacgcagcagcggcatggccgcccacctc
agcgaggtcgaccacgcgcgggcgagccgcaacggtgtcctggaactgacccgggccgag
ggcctggcgctgttcgacctcgggctgcggatggccgagtcgctgctcgtgccgatcaag
ctcgacctcgccgcgatgcgggcgagcacggtcccggtcctgttccgcggcctggtccgg
ccgagccggacccaggcgcgcacggcgtccactgtggaccgggggctggccgggcggctc
gccgggctgccggtggccgagcgggcggcggtgctggtcgacctggtgcgcgggcaggtc
gcggtcgtgctcggctacgacgggccggaggccgtccgcccggacacggcgttcaaggac
accgggttcgactcgctgacgtcggtggaactgcgcaaccggctgcgcgaggcgaccggg
ctcaagctccccgccacgctcgtcttcgactacccgaaccccttggcggtggcgcgctac
ctgggcgcgcggctggtcccggacgggaccgcgaacggcaacgggaacgggaatgggcac
agcgaagacgaccggctgcggcacgcgctggcggccatcgcggccgaggacgcgggcgag
gagcggtcgatcgccgacctgggcgtcgacgacctcgtgcaactggctttcggcgacgag
tga

DBGET integrated database retrieval system