KEGG   Amycolatopsis mediterranei RB: B737_1184Help
Entry
B737_1184         CDS       T02804                                 

Definition
(GenBank) hypothetical protein
Organism
amz  Amycolatopsis mediterranei RB
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AGT81848
LinkDB All DBs
Position
1263495..1266677
Genome map
AA seq 1060 aa AA seqDB search
MNSCRRRSAPAFSMGREGLDRIAPIHPTSRRLPRAGGRALAEDEHVGRKFGRRGKPGAGE
PRDPAALFGAPQPPRQSARPASSTPLADQLGQGYPGVDAGYVVLPRSLAEGMSLPWQHQM
AALLAQFHAEHAGLAWPIYRVVPSRYEKLADLDEEQLAEAGYLVEMDADGEMVYRERSGR
KVQDPENTSVLVSTLDPIPKPAGRPAPPAASPSGHVPAAAPAPMNIGPAPVWRTVPHPPP
AQSVPGTPEQHGWARSAPEETAQPGRGYEPVPPAPTVSGSAASSASVAPAASAASPVEPQ
WSVTAESELPGPVRAPQSSPRHAAAAQPEERGVELSARPETPAAAVAPAHSPVPAEPATR
PEGMVSPISEALGSESLASERGVSSSLEQAAASVSEPAVAEVPQAEARPEAGPVSTPQDV
DHLEPPAATSGEVASRDADRSDVAGSASSESVSRDVDRPGVAASALGESVSGDADRSGAV
APASGEPVPEEAAAPGEPASADVDRRDAAPSPAESMPRDFDQPEVATSASSEPAPRDAEA
AVPASGEPADRQEVLASTAGESLSREAERPETAGSAPRDVSWSEAAPESALQNSDQSEAA
ESPSAEPALQDAARQETAEPAAAEEVSSNEPPTEAAAPEPPEAEEGRPEAAAPTAVDQEP
VQPVGSDSRPSSSTAPQEVPSATSQPPAPQGDPQPAPEPQGPGAILRPPTAPGVAQPAAE
PQAAPDAVPQPAAASAAEPPTAPDVASQPTTAPGEVPRPASPEAQPPMLGSHLPKPPWGQ
VELPAPGLGPVPGSAPGLNPAPTHGAGPGAAPAQGAGSAPVPSSAPGVDSSAVPGTHQGA
GPAQGPGPARSPMAPGTGQAGSPAVPINWQGSARSAGPAGAPVAPATSPAATPAAHGATP
APTQGMTPASGTPAPVQGTTPAPGTTPVPHPAQGTTPAPSTPPVPHPAPSPAPPARPKPV
FPGPESTPQPFPARHAAPARPVFPGPGTMPPVPPPAPNARPVFPGRDTPLPQPSRQEPET
PPRGTARGWFDEFTETKEPEEPQDFGPTGQPTEIPYRYKR
NT seq 3183 nt NT seq  +upstreamnt  +downstreamnt
gtgaactcgtgccgcaggcggtccgccccggcgtttagcatgggtcgcgagggcctggac
aggatcgcaccgattcacccgacgtcgcggcgcttgccacgagcaggtggccgcgcactg
gcagaggatgagcacgtgggacgcaaattcggcaggcggggcaagcccggagcgggcgag
ccccgggacccggcggcgctgttcggcgcgccacagccgccccggcagagcgcccgtccc
gcgtccagcaccccgctcgccgaccagctcggccagggctacccgggggtggacgcgggg
tacgtggtgctgcctcgttcgctggccgagggcatgtcgttgccgtggcagcaccagatg
gcggcgctgctggcccagttccacgcggagcacgcgggcctggcctggccgatttaccgg
gtggtgccatcgcggtacgaaaagctggcggacctcgacgaagagcagctcgcggaggcg
ggctacctggtcgagatggacgcggacggcgagatggtctaccgcgagcgaagtggccgc
aaggtccaggatcccgagaacacctcggtgctggtgtcgaccctggacccgatccccaag
ccggcgggccgcccggcgcccccggcggcctcgccgtcaggccacgtcccggcggcggca
ccggccccgatgaacatcggcccggccccggtgtggcgaacggtgccccacccgcccccg
gcgcagtcggtgccgggaacgcctgagcagcacgggtgggcgcggtcggctccggaggag
acggcgcagccgggtcgcggctatgagccggtgccgccggctccgacggtgtccgggtct
gcggcttcgtcggcttcggtggcgcctgctgcttcggcggcgtcgccggtggagccgcag
tggtcggtgacggccgagtcggagctgcctggcccggtgagggccccacagtcatcccca
cggcacgcggcggcggctcagccggaggagcgcggcgtggagctgtctgctcgtccggag
actcctgcggcggcggttgctccggctcattcgccggttcccgccgagcctgcgacccgt
cctgagggcatggtttcgccgattagtgaggcgcttggatccgagagcctggcgtccgag
cgtggggtgtcgtcgtcgcttgagcaggctgcggcttcggtgagcgagcccgcggtggca
gaggtccctcaagcggaggcgcggccggaagcgggaccggtttcgactccgcaagatgta
gatcacctggagccccctgccgcgacctcgggcgaggtggcgtcgcgggatgcggaccgt
tcagatgttgctgggtcggcatcgagcgagtcggtgtcgcgggacgtggatcggccaggc
gttgccgcgtcggctctgggcgagtcggtgtcgggggatgcggaccggtcaggcgccgtc
gcaccggcctcgggcgaaccggtgccggaggaggctgcggccccgggcgaaccggcgtcg
gcagatgtggatcggcgagatgccgcgccgtcaccggccgagtcgatgccccgggacttc
gaccagccagaggtcgctacttcggcatcgagtgagccggcgccacgcgatgcggaggcg
gcagtaccggcatcgggcgaacctgcggatcggcaagaggtcctcgcctcgacagcgggc
gaatcgttgtcgcgagaggcggagcggccagagaccgccggatcggcgccgcgggacgtg
agctggtccgaggctgcgccagaatcggcgctgcagaactccgaccagtcggaagctgcc
gaatcgccatccgccgaaccggcgctacaggatgctgctcgccaggagacggcggaacct
gcggcggccgaagaggtgtcgtcgaacgagcccccgactgaggcggctgcacccgagcct
ccggaggccgaggaaggccgccccgaggcagccgcgcccactgcggtggatcaggaaccg
gtccagccggtggggtctgactcccggccaagctcgtccaccgcgccgcaggaagtgcca
tctgcgacttcgcagcccccagccccccagggcgacccgcaaccggctcccgaaccgcag
ggacccggtgccattttgcggccgccgactgcaccgggcgtcgcgcaaccggccgccgaa
ccgcaggctgcccccgatgcggttccgcagccggcggctgcttcggccgccgaacccccg
acggcaccggatgtggcttcccagccgacgacagcgccgggcgaagtgcctcggcccgct
tctccggaggcgcaaccaccgatgctcggctcgcatctgcccaagccgccctggggacag
gtcgagctgccggcgcccggtctcggcccggtgccgggctccgcaccgggcctcaacccg
gcgccgacgcacggcgccggcccaggtgctgcccctgcgcaaggcgccggttccgcgccg
gtgcccagctccgcgcctggcgttgactcttccgcggtaccaggtacccaccagggggcc
ggcccggcgcaaggtcccggcccggcaaggtccccgatggcgcctggcactggccaggcc
ggctcgcccgcggtgcccatcaactggcagggctccgcgcgcagtgcgggcccagcaggg
gccccggtcgcgcccgccaccagcccggccgctactcccgcagcccacggcgccacgcca
gctcccacgcaaggcatgaccccggcctccggcaccccagcccccgtgcaaggcaccacc
ccggcacccggcaccacgccggttccccacccagcacaaggcaccaccccggcacccagc
accccgccggttcctcaccccgccccaagccccgccccacccgcacgtcccaagccggtc
tttcccgggccggaatcaaccccccagccgttccccgcccggcatgccgctccggctcga
cccgtcttcccgggcccagggaccatgccgcccgttccgcctccggcgcccaacgcccgg
cccgtcttccccgggcgcgacacccctcttccgcagccctcgcggcaagagcccgagacc
ccgccccggggtaccgcgcggggctggttcgatgaattcaccgaaaccaaagagcccgaa
gaaccccaggacttcggccccaccgggcagccgaccgagatcccttaccggtacaagcgc
tga

DBGET integrated database retrieval system