KEGG   Amycolatopsis mediterranei RB: B737_1731Help
Entry
B737_1731         CDS       T02804                                 

Gene name
ddlA
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
amz  Amycolatopsis mediterranei RB
Pathway
amz00473  D-Alanine metabolism
amz00550  Peptidoglycan biosynthesis
amz01100  Metabolic pathways
amz01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:amz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    B737_1731 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B737_1731 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    B737_1731 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:amz01011]
    B737_1731 (ddlA)
Enzymes [BR:amz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     B737_1731 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:amz01011]
 Precursor biosynthesis
  Amino acid ligase
   B737_1731 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AGT82395
LinkDB All DBs
Position
1880357..1881451
Genome map
AA seq 364 aa AA seqDB search
MSEKIRVAVVFGGRSSEHTISCLSAGSVLGHLDPERFEAVPVGITREGRWVLGSGDSAQL
AVRGRELPSVDDGQGLVLAGDPSSQGLVAVEAGRESELLSRVDVVFPVLHGAFGEDGTIQ
GLLELAGIPYVGPGVLASAAAMDKETAKKLLAAEGLPVGTFSALKRGQSTLEQTDREKLG
LPVFVKPSRAGSSVGISRVADWAGLDAAIALARATDPKVLVEAAVVGREVECGVLEFPDG
HVEASLPAEIRVLSEDENAWYDFETKYLGDDAELDIPAKLDDALTEKLRAMAVEAFRALD
CQGLARVDFFVTEDHQLIINEVNTMPGFTTKSAYPKMWEVTGMDYPTLLTTLVETAIARG
TGLR
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaagatccgggtggccgtcgtgttcggtgggcgcagcagcgagcacaccatc
tcgtgcctgtccgccggcagcgtcctcggccacctcgatcccgaacggttcgaggccgtc
ccggtcggaatcacccgggaaggccggtgggtgctcggctccggggactccgctcagctc
gccgtccgcggccgggaactcccgtccgtcgatgacggccagggcctcgttctcgccggg
gatccgtccagccagggcctcgtcgccgtcgaagcggggcgggagagcgaattgctttcg
cgcgtcgatgtcgtcttccccgtgctgcacggggccttcggcgaggacggcaccatccag
ggcctgctcgagctcgccgggatcccctacgtcggccccggggtgctcgccagcgccgcc
gccatggacaaggaaaccgccaagaaactgctcgccgccgaagggctgccggtcgggacc
ttctccgcgctcaagcgggggcagtccactttggagcaaaccgaccgggaaaagctcggc
ctccctgtcttcgtcaagccgtcccgggccggctcctcggtgggcatctcgcgcgtcgcc
gattgggccgggctggacgccgccatcgcgctcgcccgcgccaccgatcccaaggtgctc
gtcgaggccgccgtcgtcgggcgggaggtcgagtgcggggtcctcgaattccccgacggc
cacgtcgaagcttcgctgcccgccgagatccgcgtcctgtccgaggacgagaacgcctgg
tacgacttcgaaaccaagtacctcggcgacgacgccgagctcgacatccccgccaagctc
gacgacgccctcaccgagaagctccgggcgatggccgtcgaagcgttccgggcgctggac
tgccagggcctggcccgggtcgacttcttcgtcaccgaagaccaccagctgatcatcaac
gaggtcaacaccatgccgggcttcacgacgaagtccgcctacccgaagatgtgggaggtc
accggcatggactacccgacgctgctgaccaccctcgtcgagacggcgatcgcccgcgga
acgggcctgcgctag

DBGET integrated database retrieval system