KEGG   Amycolatopsis mediterranei RB: B737_2642Help
Entry
B737_2642         CDS       T02804                                 

Gene name
lig
Definition
(GenBank) ATP-dependent DNA ligase
Organism
amz  Amycolatopsis mediterranei RB
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AGT83306
LinkDB All DBs
Position
complement(2863992..2865071)
Genome map
AA seq 359 aa AA seqDB search
MPLPLQPPLKPMLAKPAKAIPESGGLLFEPKWDGFRCIVFRDGDELYLQSRAEKPLNRYF
PEAVARLLDTLPPRVVLDGELVVARDGRLNFDALTERIHPAESRITLLSAEQPAEFVAFD
VLALGDDLLLDEPTSVRRERLTELAGDRFPLTPATTDPATARHWFELFEGAGLDGVIGKP
LDEPYTPGKRVMLKYKHLRTADCVLAGLRWHVDGGPGELVGSFLLGLYDEKGVLHHVGTV
GAFPKDRRRELAEELAPLITDGEDHPWGGRATGEAQRIPGGITRWRATEHEWVPLRPERV
VEVAYENTEGGMPSRFRHNARFKRWRPDREPASCDYSQLEEPARYDLDAVFRGQVVRTR
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcccctaccgctgcagccgccgctgaagccgatgctcgccaagcccgccaaggccatc
cccgaatccggtggcctgctgttcgaaccgaagtgggacggcttccgctgcatcgtcttc
cgcgacggcgacgagctgtacctgcagtcgcgcgcggaaaagccgctcaaccggtacttc
ccggaggccgtcgcgcggctgctggacaccctgccgccgcgggtcgtgctcgacggcgag
ctcgtcgtcgcgcgcgacggacggctgaacttcgacgccctcaccgagcgcatccacccc
gccgaaagccggatcacgctgctgtccgccgagcagcccgccgagttcgtcgccttcgac
gtcctggccctgggggacgacctgctgctcgacgaaccgacgtccgtccgccgcgaacgc
ctcaccgaactggccggcgaccggttcccgctcaccccggcgaccaccgatcccgccacc
gcgcgccactggttcgagctgttcgaaggcgccggcctcgacggcgtcatcggcaagccg
ctcgacgagccctacacccccggcaagcgcgtgatgctcaagtacaagcacctgcgcacc
gccgactgcgtgctcgccggcctgcgctggcacgtcgacggcggcccgggcgaactcgtc
ggctccttcctgctcggcctgtacgacgaaaagggcgtgctgcaccacgtcggcaccgtc
ggggcgttccccaaggaccgccgccgcgaactcgccgaagagctggcgccgctgatcacc
gacggcgaggaccacccgtggggcggccgggccaccggtgaggcccagcgcatccccggc
ggcatcacccgctggcgcgccaccgagcacgaatgggtaccgctgcggcccgagcgcgtc
gtcgaggtcgcctacgagaacaccgaaggcggcatgccgtcgcggttccggcacaacgcg
cggttcaagcgctggcggcccgaccgcgaacccgcgtcgtgcgactacagccagctcgag
gagccggcccgctacgacctcgacgccgtcttccgcggccaggtggtgcggacccgctaa

DBGET integrated database retrieval system