KEGG   Amycolatopsis mediterranei RB: B737_4109Help
Entry
B737_4109         CDS       T02804                                 

Gene name
neu
Definition
(GenBank) neuraminidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
amz  Amycolatopsis mediterranei RB
Pathway
amz00511  Other glycan degradation
amz00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:amz00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    B737_4109 (neu)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    B737_4109 (neu)
Enzymes [BR:amz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     B737_4109 (neu)
Bacterial toxins [BR:amz02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   B737_4109 (neu)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 BNR BNR_3 Sortilin-Vps10 DUF4185
Motif
Other DBs
NCBI-ProteinID: AGT84773
LinkDB All DBs
Position
complement(4571951..4573444)
Genome map
AA seq 497 aa AA seqDB search
MKITRLAQGLLAGLLGCAALAVPAAIGAATAQADVASTLVFNKDTEGHDCYRIPTIVKAN
NGDLLAFAEGRNGGAHACADLGKIDLVMKRSTDGGKTWGALNTVITAFGDTKGNPAPIVI
PGSDRIVLLSTMQCYTNPDCGRIPRVSISEDNGKTWGAPKTLTTELGFSAAPGWLATGPS
HGIVLTRGAHKGRLVAGMSYSNIGALVYSDDKGSTWHLGATDKPTTSAMNPQEISVTELR
DGRIYAAARNQANDGNKCLEDGTHNRAFAISSDDGATFSSKFDFATDLVAPTVEGSTARM
SATDTGGKYNRILFAAPSVCGEREGLRVHSSFDEGANWTGTAGSLLVWGQGAAYSDMVQL
SQSSVGVLFEVGPTEHPYDAIRFAAVSDAALGAPACGGGYSVIDSAPLGTGGAAGTVYLS
YNAANGQNCVSTMKNASAGTATATAAYLEVKGSARQTDSGSFSYFAGPVKATAADKCVKW
GGAAGGQVYDSQFEHCS
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatcacccgactcgcccagggcctgctggccggcctgctggggtgcgccgccctg
gcggtcccggcggccatcggcgccgcgaccgcgcaggccgacgtggccagcacattggtg
ttcaacaaggacaccgagggccacgactgctaccgcatccccaccatcgtcaaagcgaac
aacggcgacctgctcgcgttcgccgaaggccgcaacggcggcgcccacgcctgcgccgac
ctgggcaagatcgatctcgtgatgaagcgttccaccgacggtggcaagacgtggggcgcg
ctgaacaccgtcatcacggcgttcggggacacgaagggcaaccccgcaccgatcgtcatc
ccgggcagcgaccggatcgtgctgctgtcgaccatgcagtgctacaccaatcccgactgc
ggccggatcccgcgcgtgtccatcagcgaggacaacgggaagacgtggggcgcgccgaag
acgctgaccacggaactcggcttctcggccgcgccgggctggctggccaccgggccgtcc
cacgggatcgtgctgacgcgcggcgcgcacaagggccggctcgtcgccgggatgagctac
tcgaacatcggcgcgctggtctacagcgacgacaagggcagcacctggcacctcggcgcc
accgacaagccgacgacgagtgcgatgaacccgcaggagatcagcgtcaccgagctccgg
gacggccggatctacgccgccgcgcgcaaccaggcgaacgacggcaacaagtgcctcgag
gacggcacgcacaaccgcgccttcgcgatcagctcggacgacggcgcgacgttcagctcg
aagttcgacttcgccaccgacctcgtcgcgccgacggtcgagggctcgacggcccggatg
agcgccaccgacaccggcggcaagtacaaccggatcctgttcgccgcaccgtccgtttgc
ggcgagcgcgaggggctgcgcgtgcactcgtcgttcgacgagggcgccaactggaccggc
accgccggcagcctgctcgtgtgggggcagggcgcggcgtactcggacatggtgcagctg
tcgcagtcgtcggtcggggtgctgttcgaggtgggtcccacggagcacccctacgacgcg
atccgcttcgcggcggtcagtgacgccgcgctcggcgccccggcctgcggtggcggctac
agcgtgatcgactcggcgcccctgggcaccggcggcgcggccggcacggtgtacctgtcg
tacaacgcggccaacggccagaactgcgtcagcaccatgaagaacgcctccgccgggacg
gccaccgcgaccgcggcctacctggaggtcaagggctcggcgcggcagaccgactcgggc
tcgttctcctacttcgccggcccggtcaaggccacggcggcggacaagtgcgtgaagtgg
ggcggcgcggccggcggccaggtctacgacagccagttcgagcactgcagctga

DBGET integrated database retrieval system