KEGG   Amycolatopsis mediterranei RB: B737_4139Help
Entry
B737_4139         CDS       T02804                                 

Gene name
lig
Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
amz  Amycolatopsis mediterranei RB
Pathway
amz03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:amz00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    B737_4139 (lig)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:amz03400]
    B737_4139 (lig)
Enzymes [BR:amz01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     B737_4139 (lig)
DNA repair and recombination proteins [BR:amz03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     B737_4139 (lig)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AGT84803
LinkDB All DBs
Position
4607931..4609508
Genome map
AA seq 525 aa AA seqDB search
MAADPARKLRRYQEMRDFGRTAEPAGGSAGPDGHRFVVQRHRARRLHYDFRLELGGVLVS
WAVPKGPTLDPKARRLAVHVEDHPIEYAGFEGVIPRGEYGGGDVIVWDRGVWRPVEPDPA
RAIEAGTLHFDLEGEKLAGRFVLVRTSRGEKDQWFLLHKQDEHAQAGWDAEDHPRSVKSG
RTNDEVAAAPDALWHGDRPAAEAEESVGGWQAPTEDELAALDALGVKGRWSVAGRELALT
NLDKVLFPAAGGGKPVTKRDLIRYYATVGPVMLPYLAGRPLNTHRFPQGVTEPGFWQKEV
PRHAPDWLTTWRNERAEPGESRRYVVADSVATLAWLANYGALELHAWTSRAADVDHPTWV
LFDIDPGPETTFEEVLELARLHRTALEHLGLTGRPKVTGQRGIQVWVPIAPHCTFEQTRA
WAETVSRTIGRVLPDLVSWAWTKDKRRGRARLDYTQNVLNKTLVAPYSVRPRPGAPVSVP
LEWAELDDPRLAPDRWTIRDVPGRLAEHGDPFSVLLGLEQKLPGL
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagacccggcccgcaaactgcggcgctaccaggagatgcgcgacttcggccgt
accgcggagccggccggcgggtccgccggtccggacggccaccggttcgtggtgcagcgg
caccgcgcgcgccggttgcactacgacttccgcctcgaactcggcggcgtgctggtcagc
tgggcggtgccgaagggcccgacgctggacccgaaggcccgccggctggccgtgcacgtc
gaagatcacccgatcgagtacgccgggttcgagggcgtcatcccgcgcggcgagtacggc
ggcggggacgtcatcgtctgggaccgcggcgtctggcggccggtcgaacccgacccggcg
cgcgcgatcgaggccgggacgctgcacttcgacctcgaaggcgagaagctggccgggcgg
ttcgtcctcgtccgcaccagccgcggcgagaaggaccagtggttcctcctgcacaagcag
gacgagcacgcgcaggccggctgggacgccgaggaccacccgcgctcggtgaagagcggc
cgcaccaacgacgaggtcgcggccgctcccgacgccttgtggcacggcgaccgtccggcc
gccgaggcggaggagtccgtcggcggctggcaggccccgaccgaagacgaactggccgcc
ctcgacgccctgggcgtcaagggccggtggtcggtggcgggccgcgagctggcgctgacc
aacctggacaaggtgctcttcccggcggccggtggcgggaagccggtgaccaagcgggac
ctcatccggtactacgccaccgtcggcccggtcatgctgccgtacctggccggccgcccg
ctcaacacccaccggttcccccagggcgtcaccgagccgggcttctggcagaaggaggtc
ccgcggcacgcgcccgattggctgaccacgtggcgcaacgagcgcgccgagccgggggag
agccggcggtacgtcgtcgccgacagcgtcgcgaccctggcctggctggcgaactacggc
gcgctggagctgcacgcctggacttcccgcgccgccgacgtcgaccacccgacgtgggtg
ctgttcgacatcgacccgggcccggagacgacgttcgaggaggtcctggagctggcgcgg
ctgcaccgcaccgcgctcgagcacctgggcctcaccggacggcccaaggtgaccgggcag
cgcggcatccaggtgtgggtgccgatcgccccgcactgcacgttcgagcagacccgcgcg
tgggcggagacggtgtcccggacgatcgggcgggtgctgcccgacctggtcagctgggcc
tggacgaaggacaagcgccgcggccgcgcccggctggactacacgcagaacgtgctgaac
aagacgctcgtcgcgccctacagcgtccgtccgcggcccggcgcgccggtttcggtgccg
ctggagtgggccgagctggacgacccgcggctcgcgcccgaccggtggacgatccgggac
gtccccggccgcctggctgagcacggagacccgttctcggtgctgctcggtctcgaacag
aagctgccgggcctgtag

DBGET integrated database retrieval system