KEGG   Amycolatopsis mediterranei RB: B737_4536Help
Entry
B737_4536         CDS       T02804                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
amz  Amycolatopsis mediterranei RB
Pathway
amz00500  Starch and sucrose metabolism
amz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    B737_4536
Enzymes [BR:amz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     B737_4536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AGT85200
LinkDB All DBs
Position
5058417..5060642
Genome map
AA seq 741 aa AA seqDB search
MISWKALLACTGTAILLAAALPATALATGTATDCCGGGASWATGNKSALGTATTTTSPVW
FTVADGITSEVFYPRADIPNSQDRQFIVTDGSTFVDLERDATNHVVTVPDEKALQYTITN
TAKSGKYRITTDYVTDPARATLVTNTRFQSLDGGSYRLYLLANPSMAGGGANDNAWWDST
GALMASGTETLFGGTATTVVSALRVSTGFTAHDNGYSGAASDCLVDLRADKTLTNQFDAV
SGTGNVVQCGQIPVGTDTTFTVAQGYGDTTAAATSAASGSLSSGFTAVASSYRSGWNAYV
NSLKPAPASVSGDTQRRRAYYVAAMALKTAEDKQHPGASVAGLATPWGNFTNGDQLNDGY
HRVWGRDLYQQATGLLAAGDSAQAKRMAQFLWNAQWIGSPTAGDGMTYPAGSFPRYSPVS
GVAGASAQQLGCCEQLDQDADAILLAWLTGLTDASTYAKVKTTANHIVATGPDTTERWEE
QYGKSPSSVAAEIAGLIAAGAIARANGDTASASSWESTADSWRNSLAGWTVTTSGYWGGH
TYYERLDRAGNPNDTATICFDEGCFYEHDVTDFGFLDLVRLGIRPAGDATIANSVAPTAA
ASDGNSALQVTLPNGDVYFHRYPHDNYGESTANCSGWPAGGAQRFGRLWPVLSGERGQYE
LANGRSAAVYLKSMADSANEGYFVPEQVWDRADVGCFGLGRPTGSAGPLMWAEGQYLRLA
QSMDAGHNLDTPSIVKARYGT
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgatcagctggaaagcactcctggcctgcaccggaacagcaatcctcctagccgcagcc
ctccccgccacggccctggccaccggcaccgcaaccgactgctgcggaggcggagcctcc
tgggcaaccggcaacaagtccgccctcggcaccgccaccaccacgaccagcccagtctgg
ttcaccgtcgccgacggcatcacatccgaggtcttctacccccgagccgacatccccaac
tcccaggaccgccagttcatcgtcaccgacggctcgacgttcgtcgacctggagcgcgac
gccacgaaccacgtggtgaccgtgcccgacgagaaggcactccagtacacgatcacgaac
acggccaagagcggcaaataccggatcaccaccgactacgtcaccgacccggcccgcgcc
acactggtcacgaacacccgcttccagtcgctcgacggcggcagctaccggctctacctg
ctggccaacccgtcgatggcgggcggcggcgcgaacgacaacgcctggtgggactcgacc
ggagccctgatggcgagcggaaccgaaacgctgttcggcggcacggccacgacggtcgtc
tccgcgctgcgcgtctcgaccggcttcaccgcacacgacaacggctacagcggcgcggcc
agcgactgcctggtcgacttgcgcgccgacaagaccttgaccaaccagttcgacgccgtc
tccggcaccggcaacgtcgtccagtgtggacagatcccggtgggcaccgacacgaccttc
accgtcgcgcaaggctacggcgacacgacggcagcggcgacgtccgccgcaagcggctcg
ctgagcagcgggttcaccgcggtggcaagttcctaccgcagcggctggaacgcgtacgtg
aactccctcaaacccgctccggccagcgtttccggagacacgcagcggcgtcgcgcctac
tacgtcgcggccatggcgctgaagaccgccgaagacaaacagcaccccggcgcgagcgtc
gcaggcctcgccaccccctggggcaacttcacgaacggtgaccagctcaacgacggctac
caccgcgtctggggccgcgacctctaccagcaggccaccgggctcctggccgcgggcgac
agcgcgcaggccaagcggatggcccagttcctctggaacgcgcagtggatcggcagcccc
acggccggcgacggcatgacgtacccggcggggtccttcccgcgctacagcccggtgtcc
ggcgtcgccggggcgagcgcccagcagctcggctgctgcgaacagctcgaccaggacgcc
gacgcgatcctgctggcctggctgaccggcctcaccgacgcctcgacctacgccaaggtc
aagacgacggcgaaccacatcgtcgccaccggcccggacaccaccgagcggtgggaggag
cagtacggcaagtcgccgtcttcggtggccgcggagatcgccgggctgatcgcggcgggg
gccatcgcgcgggcgaacggcgacacggcgagcgcgtcgtcgtgggagtccacggcggac
tcgtggcggaactccctggccggctggaccgtcacgacgtccggctactggggcggccac
acctactacgagcgcctcgaccgcgccggcaacccgaacgacaccgcgacgatctgcttc
gacgaaggctgcttctacgaacacgacgtgaccgacttcggcttcctcgacctggtgcgg
ctcggcatccgcccggccggggacgcgacgatcgccaactcggtggcgccgacggccgcg
gcgtcggacggcaactcggcgctgcaggtgacgctgccgaacggcgacgtctacttccac
cggtacccgcacgacaactacggcgagagcaccgcgaactgcagcggctggccggccggc
ggtgcccagcggttcggccggctgtggccggtgctgtcgggggagcgcgggcagtacgag
ctcgccaacggccgctccgccgcggtctacctcaagtccatggcggactcggccaacgaa
ggctacttcgtgcccgagcaggtctgggaccgcgcggacgtcggctgcttcggcctcggc
cggccgaccggcagcgcgggcccgctgatgtgggccgagggccagtacctgcggctggcg
cagagcatggacgcgggccacaacctcgacacgccctcgatcgtcaaggcccgctacggc
acctga

DBGET integrated database retrieval system