KEGG   Amycolatopsis mediterranei RB: B737_7759Help
Entry
B737_7759         CDS       T02804                                 

Gene name
gabD
Definition
(GenBank) succinate-semialdehyde dehydrogenase (NADP+)
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
amz  Amycolatopsis mediterranei RB
Pathway
amz00250  Alanine, aspartate and glutamate metabolism
amz00310  Lysine degradation
amz00350  Tyrosine metabolism
amz00650  Butanoate metabolism
amz00760  Nicotinate and nicotinamide metabolism
amz01100  Metabolic pathways
amz01120  Microbial metabolism in diverse environments
Module
amz_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:amz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    B737_7759 (gabD)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B737_7759 (gabD)
   00310 Lysine degradation
    B737_7759 (gabD)
   00350 Tyrosine metabolism
    B737_7759 (gabD)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    B737_7759 (gabD)
Enzymes [BR:amz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     B737_7759 (gabD)
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     B737_7759 (gabD)
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     B737_7759 (gabD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AGT88420
LinkDB All DBs
Position
complement(8675457..8676920)
Genome map
AA seq 487 aa AA seqDB search
MSANTESGVVEAVGKELFIGGKWVAAQDGKTFPVVDPATGKELCHVADASPSDGVAALDA
AVAAQTEFAKMAPRERGEILRRAYELLMRRQEELALLMTLEMGKPLAESKGEIAYAAEFF
RWFAEEAVRIDGGYATAPNGAGRFLITKQPVGPTLLITPWNFPMAMGTRKIGPAIAAGCT
AVIKPAAQTPLSMLALAGILAEAGLPEGVLNVVTTSDSGGVMEPLIRDGRARKLSFTGST
GVGRKLLEQCADKILRTSMELGGNAPFLVFDDADMDAAIEGAMQAKMRNIGEACTAANRF
YVQRGVVDEFARRLTERMQALPMGRGTEKDVVVGPLIDEKAVDKVTELVKDATDRGARIL
TGGSGVDGPGHFYPATVLTDVPQEARLTHEEIFGPVAPITPFDTEEEAVAKANDTEFGLV
SYLFTSDLKRALRVSEALEAGMIGLNQGIVSNPAAPFGGIKQSGLGREGGSVGIDEFLET
KYIAVAL
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgaacaccgagtccggcgtcgtcgaggcggtcggcaaggaactgttcatcggc
ggcaagtgggtcgccgcccaggacggcaagaccttcccggtggtggacccggccaccggc
aaggagctttgtcacgtcgccgacgcctcgccgtcggacggcgtcgcggcgctggacgcc
gccgtcgcggcgcagaccgagttcgcgaagatggcgccccgcgagcgcggcgagatcctg
cgccgcgcctacgagctgctgatgcggcgccaggaggaactggcgctgctgatgaccctg
gagatgggcaagccgctcgccgagtcgaagggcgagatcgcctacgccgcggagttcttc
cgctggttcgccgaggaagccgtccgcatcgacggcggctacgcgaccgccccgaacggc
gcgggccggtttctcatcaccaagcagccggtcgggccgacgttgctgatcacgccgtgg
aacttcccgatggcgatgggcacccgcaagatcggcccggcgatcgccgccggctgcacg
gcggtgatcaagcccgccgcccagacgccgctgtcgatgctcgcgctggcgggaatcctc
gccgaggcgggactgcccgaaggcgtgctcaacgtcgtcacgaccagcgactccggcggc
gtgatggagccgctgatccgtgacggccgcgcccgcaagctctccttcaccggctcgacc
ggggtcggccgcaagctgctcgaacagtgcgccgacaagatcctgcggacgtcgatggag
ctgggcggcaacgcgccgttcctggtcttcgacgacgcggacatggacgcggccatcgag
ggcgccatgcaggcgaagatgcgcaacatcggcgaggcgtgcaccgcggcgaaccggttc
tacgtgcagcgcggcgtcgtcgacgagttcgcgcggcggctgaccgaacgcatgcaggcg
ctgccgatgggccgcggcaccgagaaggacgtcgtcgtcggcccgctgatcgacgagaag
gccgtcgacaaggtgaccgagctggtcaaggacgccaccgaccgcggcgctcggatcctc
accggcggctcgggcgtcgacgggccggggcacttctacccggccacggtgctcaccgac
gtcccgcaggaggcgcggctgacgcacgaggagatcttcgggccggtcgccccgatcacg
ccgttcgacaccgaagaagaggcggtggcgaaggcgaacgacaccgagttcgggctcgtt
tcctacctcttcaccagcgacctcaagcgcgccctgcgggtttcggaagcgctggaagcc
gggatgatcgggctcaaccagggcatcgtctcgaacccggcggcgccgttcggcgggatc
aagcagtccgggctcggccgcgaaggcggctcggtcggcatcgacgagttcctggagacc
aagtacatcgcggtcgccctgtga

DBGET integrated database retrieval system