KEGG   Amycolatopsis mediterranei RB: B737_7760Help
Entry
B737_7760         CDS       T02804                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
amz  Amycolatopsis mediterranei RB
Pathway
amz00250  Alanine, aspartate and glutamate metabolism
amz00410  beta-Alanine metabolism
amz00640  Propanoate metabolism
amz00650  Butanoate metabolism
amz01100  Metabolic pathways
amz01120  Microbial metabolism in diverse environments
Module
amz_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:amz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    B737_7760 (gabT)
   00650 Butanoate metabolism
    B737_7760 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B737_7760 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B737_7760 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:amz01007]
    B737_7760 (gabT)
Enzymes [BR:amz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     B737_7760 (gabT)
Amino acid related enzymes [BR:amz01007]
 Aminotransferase (transaminase)
  Class III
   B737_7760 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 GGN
Motif
Other DBs
NCBI-ProteinID: AGT88421
LinkDB All DBs
Position
8677012..8678268
Genome map
AA seq 418 aa AA seqDB search
MAQLSPLLKQATPVVVDHGEGVYLYDLEGKRHLDFTAGIGVTSTGHCHPHVVRAAQEQIG
KLVHGQYTTVMHKPLLELTERLGEVLPGGLDSLFYANSGSEAVEAALRLSRQATNRPNVI
VFQGGFHGRTVAAATMTTSGTRFSAGIGPLMTGVHVAPFPYAYHYGWDEQTATKFALREL
DYLFQTVCAPNETAAFFVEPVLGEGGYVPANTEFLAGLRERADRHGILLVVDEIQTGFGR
TGKFWGHDHFDVSPDIVLIAKGLASGFPLSGIAASQELMAKAFPGSQGGTYGGNAVSCAA
AIATLEVIQQENLVENAAERGRQLLEGARVIADKTPSIGEVRGLGLLVGSEFSTADGEPD
TPTAQAAQQAAAKSGLLLLTCGPYMNVVRMVPPLVVTAEQVDDALRIWGDVVASVTGS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtggcccagctctctccgctgctcaagcaggcaacgcccgtcgtggtcgaccacggtgaa
ggggtttacctctatgacctcgagggcaaacgccacctcgacttcaccgccggtatcggc
gtcacgagcaccgggcactgccacccccacgtggtgcgggccgcgcaggagcagatcggc
aagctcgtccacggccagtacacgacggtcatgcacaagccgctcctcgaactcaccgag
cgcctcggcgaggtcctgcccggcgggctcgactcactcttctacgcgaactcgggcagc
gaagccgtcgaagcggcgttgcggctttcgcggcaggcgacgaaccgcccgaacgtcatc
gtcttccagggtggcttccacggccggacggtcgccgccgcgaccatgacgacgtccggg
acgcggttcagcgccggcatcggcccgctgatgaccggcgtgcacgtcgcgccgttcccg
tacgcctaccactacggctgggacgagcagacggcgacgaagttcgcgctgcgcgagctg
gactacctcttccagaccgtctgcgcgccgaacgagaccgccgcgttcttcgtcgaaccc
gtgctgggcgagggcgggtacgtcccggcgaacaccgagttcctggccggcctgcgcgag
cgcgccgaccggcacggcatcctgctcgtcgtcgacgagatccagaccggcttcggccgc
accgggaagttctggggccacgaccacttcgacgtctcccccgacatcgtcctcatcgcg
aagggcctggccagcggcttccccctgtccggcatcgccgcttcgcaggagctgatggcg
aaggcgttccccggctcgcagggcgggacgtacggcggcaacgcggtttcgtgcgccgcg
gcgatcgcgacgctcgaggtcatccagcaggagaacctggtcgagaacgccgccgagcgc
gggcgccagctgctcgaaggcgcgcgggtgatcgcggacaagacgccgtcgatcggcgaa
gtgcgcgggctcgggctgctggtcggctcggagttcagcaccgccgacggcgaaccggac
acgcccaccgcgcaggccgcccagcaggcggcggcgaagagcgggctgctgctgctcacc
tgcgggccgtacatgaacgtcgtccggatggtgccgccgctggtcgtcaccgccgagcag
gtcgacgacgcgctgcggatctggggcgacgtcgtcgcctcggtcacggggagctga

DBGET integrated database retrieval system