KEGG   Nostoc sp. PCC 7120: all0980Help
Entry
all0980           CDS       T00069                                 

Definition
(GenBank) D-alanyl-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ana  Nostoc sp. PCC 7120
Pathway
ana00473  D-Alanine metabolism
ana00550  Peptidoglycan biosynthesis
ana01100  Metabolic pathways
ana01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ana00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    all0980
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    all0980
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    all0980
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ana01011]
    all0980
Enzymes [BR:ana01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     all0980
Peptidoglycan biosynthesis and degradation proteins [BR:ana01011]
 Precursor biosynthesis
  Amino acid ligase
   all0980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: BAB72937
CyanoBase: all0980
CYORF: all0980
UniProt: Q8YY71
LinkDB All DBs
Position
complement(1144905..1145999)
Genome map
AA seq 364 aa AA seqDB search
MRVGLLFGGRSGEHEVSISSARAIASALSAGENASKYEILPFYIHKDGRWLAGEAPQQVL
KSGAPLLESSNSSPAENNLVNSQQQTLERWQSPSQVAEVDVWFPILHGPNGEDGTIQGLL
TLMQTPFVGSGVLGSALGMDKIAMKMAFEQAGLPQVKYKAVTRAQIWSNPCVFPKLCDEI
EASLGYPCFVKPANLGSSVGISKVRSRQELEDALDNAANYDRRIIIEAGVAAREVECAVL
GNDQPQASTVGEITFNSDFYDYETKYTAGKADLLIPAIIPDDISRQIQNMALQAFAAVDA
AGLARVDFFYVEATGEVLINEINTLPGFTATSMYPQLWAHSGIPFPELVDKLVQLAIERH
NPSH
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
ttgagggtgggattgttatttggcggtcgttctggagaacatgaagtttctataagttcc
gcacgggcgatcgcttcagccctaagtgcaggagaaaatgctagtaagtatgaaatattg
ccgttttatatccacaaggatgggcgttggctagcaggagaagccccacaacaggttttg
aaatcgggtgcgcctctattagaatcatcaaactcctcaccagcagaaaataatctcgta
aactcccaacaacaaaccctcgaacgttggcaatcaccttcccaagttgcggaagtagat
gtgtggtttcccattctccacgggcctaatggtgaagatgggacaattcaggggttactc
accttaatgcaaactcctttcgtcggttctggcgttttgggttcagcactggggatggat
aagatagccatgaagatggcttttgagcaagctggactaccccaagtaaaatataaggct
gtcaccagagcgcaaatttggtcaaatccttgcgtatttcccaaattatgcgatgaaatt
gaggcgagtttaggttatccctgttttgtcaaaccagctaaccttggttcttctgtagga
atttctaaagtgcgatcgcgccaagaattagaagatgctttagataatgccgctaattat
gaccgccgaattattatcgaagctggagtagcagccagggaagtagaatgtgctgtttta
ggtaacgaccaaccccaagcttccacagtcggcgaaattacctttaatagtgacttttat
gattacgaaaccaaatatacggcaggtaaagcagatttactgattcctgccattattccc
gatgacatcagccgtcaaattcaaaacatggctttacaagccttcgcagctgttgacgct
gccgggttagccagagtagactttttctacgtggaagctacaggagaagtgttgattaat
gagatcaacaccctaccaggtttcaccgctaccagtatgtatccccaactctgggcccat
agtggcatcccctttccagaattggtggataagttagttcaactggctatagaaagacat
aatcctagtcattag

DBGET integrated database retrieval system