KEGG   Nostoc sp. PCC 7120: all1272Help
Entry
all1272           CDS       T00069                                 

Definition
(GenBank) probable glycogen phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
ana  Nostoc sp. PCC 7120
Pathway
ana00500  Starch and sucrose metabolism
ana01100  Metabolic pathways
ana01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ana00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    all1272
Enzymes [BR:ana01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     all1272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase
Motif
Other DBs
NCBI-ProteinID: BAB73229
CyanoBase: all1272
CYORF: all1272
UniProt: Q8YXE1
LinkDB All DBs
Position
complement(1510514..1513078)
Genome map
AA seq 854 aa AA seqDB search
MQPIRTFNVSPSLPPRLEPLRRLAYNLHWDWNVETKDLFRRLDPDLWESSHHNPVLMLGT
ISQGRLLEVVEDEGFLAQLDRANRQLDDYLQERSWYHKQRGQQPKECYAYFSAEFGLVDC
LPVYSGGLGVLAGDHLKSASDLGLPLVGVGLLYQQGYFAQYLNADGWQQERYPINDFYNM
TLHLERNPDGSELQIAVDYPGRKVYARVWRVQVGTVPLYMLDTNIEPNNPYDHDITDQLY
GGDIDMRIHQEIMLGIGGVQMLKALGYKVTAYHMNEGHAAFSALERIRLLIQEEGLSYAE
AKQVVSSSNIFTTHTPVPAGIDLFSPDKILYYLGYYADIFGLPKEQFLGLGRENTGDLSG
PFSMAVLALKMATFSNGVAQLHGVVSRQMFQGLWKKVPVEEVPIAAITNGVHARSCVAKS
TQELYDRYLGPNWSSAPPDNQLWERMDAIPDEELWRNHERCRLDMILYVRDHLVKHLRDR
GASASEILQAQEVLDPNALTIGFARRFATYKRATLWMRDVERIKRILLSNKDRKVQFVIA
GKAHPKDIPGKELIREINHFIREQHLEKQIVFVPNYDIHISRLMVAGCDIWLNTPRRPRE
ASGTSGMKAAMNGLPNLSVLDGWWDEADYVRTGWAIGHGENYDDPNYQDEVEANALYDLL
EKEVVPLFYDHRDVDGLPRPWVAKMKDAIRLNCPFFNTARMVREYAQRAYFPASDRYHTL
TSDNYAPAKELADWKAKLTDHWFNIKIKDIDVSAGADIEVNQTVAVKAKVDLTTLNNDDV
QVELYQGSIDANGDIVSAIPVVMDYQGQDTNGLSVYTANILYTTSGLQGLSLRVLPKHPH
LSSPYEPRLIAWAD
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgattcgcacattcaatgtttctccttccttgccgccgcgacttgagccgttg
cggcgactggcgtataatttacactgggattggaacgttgagactaaagatttatttcgt
cgcttagacccagacttgtgggaatctagtcaccacaatcccgtactaatgctgggtaca
atcagtcaagggcggcttttggaagttgtggaagatgaaggcttcctggcacagttggat
cgtgctaaccgtcaattagatgactacttacaagagcgtagttggtatcacaaacaacgc
ggtcagcagccaaaagaatgttacgcctatttttcggctgaatttggactggtagattgt
ctgcctgtttattctggtggtttgggcgttctggcaggggatcacttaaaatcagctagt
gatttagggctacccttggttggtgtgggtttactgtaccagcaaggttattttgctcag
tatctcaatgctgatggttggcaacaagaacgttacccgattaacgatttctacaacatg
accttgcacctagaacgcaatcctgatggttcagaattgcagattgcggtggattacccc
ggacgcaaggtgtatgccagagtttggcgggtacaggtgggaacagttcccctgtatatg
ctggacacgaatattgagccgaataacccctacgaccacgacatcacagaccaactctat
ggtggtgatatcgatatgcgtatccaccaagaaattatgttgggtattggtggtgtgcag
atgttgaaggctttgggttataaagtcacggcttaccacatgaatgaaggccacgccgcc
ttctcagccctagaacgtatccgcttgttaattcaagaagaggggttgagttatgcggaa
gctaaacaggtggtgagttcgagtaacatctttacaacccatacaccagtaccggcagga
attgacttattttctcctgacaagattctgtattaccttggttattatgcagacatcttt
ggcttacccaaagagcaatttttagggttagggcgagaaaatacaggcgatttatctggg
ccgttcagtatggctgtcttggcgttgaagatggcgacattttctaacggtgtagcccag
ttacacggtgtggtttcccggcaaatgttccaaggtttgtggaaaaaggttcctgttgag
gaagtaccaattgcggcaattaccaacggtgttcatgcccgtagttgcgttgccaaatca
acccaggaattatacgatcgctacttggggccaaattggtcatcagcgccaccagataac
caattgtgggaacggatggatgcaattcctgatgaggagttgtggcggaatcacgaacgt
tgtcgcctggacatgatactctatgtgcgcgaccacttagttaaacacctgcgcgatcgc
ggtgcttctgcttccgaaattctccaagcccaggaagttcttgatcccaacgctttgact
ataggctttgcccgtcgttttgctacctacaaacgcgctaccctgtggatgcgcgatgtc
gaacgcattaaacgtattttactcagcaacaaagaccgcaaggtacaatttgtcatcgct
ggtaaagcccaccctaaagacattccagggaaagaactcatccgcgaaattaatcacttt
atccgcgaacaacacttagaaaaacaaatagtgtttgttcccaactacgacattcatatt
tcccggttgatggttgctggttgcgatatttggttaaacacaccccgccgtcccagagaa
gcatctggtactagcgggatgaaagccgccatgaatggcttaccgaacctgagtgtatta
gatggttggtgggatgaagccgattacgtccgcacaggctgggcgattggacatggggaa
aattacgatgatcccaactaccaggacgaagtagaagccaatgctctctatgatttactg
gaaaaagaagtcgtacccttattttacgaccaccgtgatgtcgatggtttaccccgtccc
tgggttgccaaaatgaaagacgctatccggttaaactgtcccttctttaatacagcgcgg
atggtcagggaatatgcacaacgagcttacttcccagcaagcgatcgctatcacacttta
acatctgataattatgccccagctaaggaattagcagattggaaagctaaacttactgac
cattggtttaatatcaaaatcaaagatatcgatgtatccgcaggtgcagatattgaagtt
aatcaaaccgttgctgtcaaagccaaagtagacttgacaacattaaacaatgatgatgtc
caagttgaactatatcaaggttccattgatgctaacggcgatatcgtcagtgctataccc
gtagtcatggattatcaaggacaagacactaatggcttgagtgtttatacagctaacatc
ctttacaccacctctggtttacaaggtttatccttgcgtgtattgccaaaacacccacac
ctgtctagtccttatgaacccaggttgattgcttgggctgactaa

DBGET integrated database retrieval system