KEGG   Nostoc sp. PCC 7120: alr0532Help
Entry
alr0532           CDS       T00069                                 

Gene name
cpcE
Definition
(GenBank) phycocyanobilin lyase alpha subunit
  KO
K02288  phycocyanobilin lyase subunit alpha [EC:4.4.1.32]
Organism
ana  Nostoc sp. PCC 7120
Pathway
ana00196  Photosynthesis - antenna proteins
ana01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ana00001]
 09100 Metabolism
  09102 Energy metabolism
   00196 Photosynthesis - antenna proteins
    alr0532 (cpcE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:ana00194]
    alr0532 (cpcE)
Enzymes [BR:ana01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.32  C-phycocyanin alpha-cysteine-84 phycocyanobilin lyase
     alr0532 (cpcE)
Photosynthesis proteins [BR:ana00194]
 Antenna proteins
  Phycobilisome - Cyanobacteria, Red alga [OT]
   Phycocyanin (PC)
    alr0532 (cpcE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEAT_2 HEAT_PBS HEAT HEAT_EZ Arm
Motif
Other DBs
NCBI-ProteinID: BAB72490
CyanoBase: alr0532
CYORF: alr0532
UniProt: P07125
LinkDB All DBs
Structure
PDB: 

Position
623306..624136
Genome map
AA seq 276 aa AA seqDB search
MIEPSVEEFPAENGPQLTPELAIANLQSSDLSLRYYAAWWLGKYRVKESAAVDALIAALE
DEADRTELGGYPLRRNAARALGKLGNRKAVPGLINCLECPDFYVREAAAQSLEMLKDKTA
APALIKLLDGGVAQAVQVTGRPHLVQPYEAVLEALGAIGATDAIPLIQPFLEHPVSRVQC
AAARAMYQLTQEPVYGELLVKVLAGNDLNLRRVALGDLGAIGYLAAAEAIANAKAENSFK
LIALKGLLEHQMSAESNALSISDQAIRVMNLMDSLL
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgatagaacccagtgtggaagaatttcccgcagagaacgggccacagctaacaccagaa
ctagccatagctaatctgcaatcatcagacttaagtctccgctattatgctgcttggtgg
ttaggtaagtatcgggtgaaagaaagtgctgctgttgatgctttaattgcggcgttagag
gatgaagccgatagaactgaacttggtggttatcctttgcggcgtaacgcagccagagca
ttagggaaattgggcaatcgtaaagccgtgccaggcttaattaactgcttggagtgtcct
gacttttacgtgcgtgaagcagcagcccaatcgctggaaatgctcaaagacaaaacagca
gcaccagcactcatcaaattactcgatgggggagtcgcacaggccgtgcaagtaacaggg
cgacctcatttagtccaaccctacgaagcagtattagaagcgttaggagctattggtgct
actgatgccatccctctgattcagccatttctagagcatccagtctcacgagtgcagtgc
gccgccgctagggcaatgtaccaactgacacaagaaccagtatatggagagctgctggta
aaagtgttagcaggtaacgacctcaacctacgacgcgttgctttaggtgacttgggtgca
attgggtacttggcagcagcagaagcgatcgctaacgccaaagccgaaaacagcttcaaa
ctcattgccctcaaaggattgctagaacatcagatgtcagcagagtcaaacgccctctca
atatctgatcaagctatccgggtcatgaaccttatggattcattgttgtag

DBGET integrated database retrieval system