KEGG   Nostoc sp. PCC 7120: alr1524Help
Entry
alr1524           CDS       T00069                                 

Gene name
rbcL
Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
ana  Nostoc sp. PCC 7120
Pathway
ana00630  Glyoxylate and dicarboxylate metabolism
ana00710  Carbon fixation in photosynthetic organisms
ana01100  Metabolic pathways
ana01120  Microbial metabolism in diverse environments
ana01200  Carbon metabolism
Module
ana_M00165  Reductive pentose phosphate cycle (Calvin cycle)
ana_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
ana_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:ana00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    alr1524 (rbcL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    alr1524 (rbcL)
Enzymes [BR:ana01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     alr1524 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: BAB77890
CyanoBase: alr1524
CYORF: alr1524
UniProt: P00879
LinkDB All DBs
Position
1785970..1787400
Genome map
AA seq 476 aa AA seqDB search
MSYAQTKTQTKSGYKAGVQDYRLTYYTPDYTPKDTDILAAFRVTPQPGVPFEEAAAAVAA
ESSTGTWTTVWTDLLTDLDRYKGRCYDIEPVPGEDNQFIAYIAYPLDLFEEGSITNVLTS
IVGNVFGFKALRALRLEDIRFPVAYIKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLG
LSAKNYGRAVYECLRGGLDFTKDDENINSAPFQRWRDRFLFVADAITKAQAETGEIKGHY
LNVTAPTCEEMLKRAEYAKELKQPIIMHDYLTAGFTANTTLARWCRDNGVLLHIHRAMHA
VIDRQKNHGIHFRVLAKALRLSGGDHIHTGTVVGKLEGERGITMGFVDLLRENYVEQDKS
RGIYFTQDWASLPGVMAVASGGIHVWHMPALVEIFGDDSVLQFGGGTLGHPWGNAPGATA
NRVALEACVQARNEGRNLAREGNDVIREAAKWSPELAVACELWKEIKFEFEAMDTV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacgctcaaacgaagactcagacaaaatctgggtataaagccggggttcaagat
tacagactaacttattacacacctgattacacacctaaagatacagatattctggcggcg
ttccgtgttacaccccagcccggagttccctttgaggaagcggctgcggctgtagcggct
gagtcttctactggtacttggacgaccgtatggacagacctgttaaccgatctagatcgt
tacaaaggtcgttgctacgatatcgaaccagttcccggcgaagacaaccaattcattgcc
tacatcgcttatcctttggatctgtttgaagaaggctccatcaccaacgttttgacctca
attgtaggtaacgtatttggttttaaagcattacgcgcattgcgtttggaagacattcgc
tttcctgttgcttacatcaagaccttccaaggccctcctcacggtatccaagttgagcgt
gacaaattaaacaaatatggtcgtcctctgttgggttgtaccatcaaaccaaaattaggt
ctgtctgctaagaactacggacgcgctgtatacgagtgtttgcgcggtggtttggacttc
accaaagacgacgaaaacattaactccgcaccattccaaagatggcgcgatcgcttcttg
tttgtagctgatgctatcaccaaagcacaagcagaaacaggcgaaatcaaaggtcactac
ctaaacgtgaccgctcctacctgtgaagaaatgctaaaacgggctgagtacgctaaagaa
ctcaaacagcccatcatcatgcacgactacctgaccgcaggtttcacagctaacaccacc
ttggctcgttggtgtcgtgacaacggcgttctactgcacatccaccgcgcgatgcacgca
gtaatcgaccgtcaaaagaaccacggtatccacttccgtgtattggctaaagccctacgt
ctatctggtggtgaccacatccacaccggtaccgtagtaggtaaattggaaggtgaacgc
ggtatcacaatgggcttcgttgacctactacgtgaaaactacgttgagcaagacaagtct
cgcggtatttactttacccaagactgggcttctctacctggtgtaatggcagttgcttcc
ggtggtatccacgtatggcatatgccagcgttggtagaaatcttcggtgatgactccgta
ctacaattcggtggtggtacactcggacacccttggggtaacgctcctggtgcaaccgct
aaccgtgtagctttggaagcttgcgtccaagcacgtaacgaaggtcgtaacttggctcgt
gaaggtaacgacgttatccgtgaagctgctaagtggtctcctgaattggctgtcgcttgc
gaactgtggaaagaaatcaagttcgagtttgaggcaatggataccgtctga

DBGET integrated database retrieval system