KEGG   Nostoc sp. PCC 7120: alr1526Help
Entry
alr1526           CDS       T00069                                 

Gene name
rbcS
Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
ana  Nostoc sp. PCC 7120
Pathway
ana00630  Glyoxylate and dicarboxylate metabolism
ana00710  Carbon fixation in photosynthetic organisms
ana01100  Metabolic pathways
ana01120  Microbial metabolism in diverse environments
ana01200  Carbon metabolism
Module
ana_M00165  Reductive pentose phosphate cycle (Calvin cycle)
ana_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
ana_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:ana00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    alr1526 (rbcS)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    alr1526 (rbcS)
Enzymes [BR:ana01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     alr1526 (rbcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small Guanylate_cyc_2
Motif
Other DBs
NCBI-ProteinID: BAB77892
CyanoBase: alr1526
CYORF: alr1526
UniProt: P06514
LinkDB All DBs
Position
1787950..1788279
Genome map
AA seq 109 aa AA seqDB search
MQTLPKERRYETLSYLPPLTDVQIEKQVQYILSQGYIPAVEFNEVSEPTELYWTLWKLPL
FGAKTSREVLAEVQSCRSQYPGHYIRVVGFDNIKQCQILSFIVHKPSRY
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccttaccaaaagagcgtcgttacgaaaccctttcttacttaccccccctcacc
gacgttcaaatcgaaaagcaagtccagtacattctgagccaaggctacattccagccgtt
gagttcaacgaagtttctgaacctaccgaactttattggacactgtggaagctacctttg
tttggtgctaaaacatcccgtgaagtattggcagaagttcaatcttgccgttctcaatat
cctggtcactacatccgtgttgtaggatttgacaatattaagcagtgccaaattctgagc
ttcatcgttcacaaacccagcagatactaa

DBGET integrated database retrieval system