KEGG   Nostoc sp. PCC 7120: alr2335Help
Entry
alr2335           CDS       T00069                                 

Definition
(GenBank) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
ana  Nostoc sp. PCC 7120
Pathway
ana00040  Pentose and glucuronate interconversions
ana00051  Fructose and mannose metabolism
ana01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ana00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    alr2335
   00051 Fructose and mannose metabolism
    alr2335
Enzymes [BR:ana01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     alr2335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C 2-Hacid_dh_C CoA_binding Cas_csx3 DUF1161 ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: BAB74034
CyanoBase: alr2335
CYORF: alr2335
UniProt: Q8YUK9
LinkDB All DBs
Position
2815238..2816296
Genome map
AA seq 352 aa AA seqDB search
MKAQVFRGVNQLSYEEIPLPILEPDEVLVQVQVVGLCQSDIKKIRYPLYEPPRIFGHETA
GTIAAVGSQVQGWQVGQRVAVMHHIPCMRCAYCMNENFSMCDVYKNISTTAGFNASGGGF
AEYVKVPGHIVENGGLIPIPDGISFEEASFVEPTNCCLKAVKKAQIAPGQTVLVTGAGPI
GLMFVMLVKYFGAKAIATDLLPSRIEKALNVGAEAAFDARDPDLPAKVHALTNGLGVDVT
LLAVPSEKAFFQALECTRKGGKILFFAEFPDELEIPINPNILYRREIDLMGSYSSSYRLQ
NLSADIVFNRRIDVQALISDRYPLKDLSAAVDQAIAPTPETYKILIYPKIGD
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcacaggtatttcgaggtgtaaatcaactctcttatgaagagatccccctaccg
attctggaaccagatgaagtgctggtacaggtgcaagtagtcggtttgtgtcagtcagat
attaaaaaaattcgttatccactttatgaaccaccacgcatctttggtcatgaaacagcc
gggactatagccgcagtgggttctcaggtacagggttggcaagtaggacaacgggtggcg
gtgatgcaccacattccttgtatgcgctgtgcctattgtatgaatgagaatttttccatg
tgtgatgtttataaaaacatctccaccactgccggatttaatgccagtggcggtggcttt
gcggagtatgtcaaggttccgggtcatattgtagagaatggtggcttaattccgattcct
gacgggatcagttttgaagaagcgagttttgttgaacctacaaactgttgcttaaaagca
gtcaaaaaagcccagattgccccaggacagactgttctggtaactggtgcagggccgatt
ggcttaatgtttgtcatgttggtgaaatatttcggggcaaaagcgatcgccaccgatttg
ctaccatcaagaatagaaaaagccctcaatgtgggtgcagaagccgcatttgatgcccgt
gatcctgatttaccagccaaagttcatgccctcaccaatggactaggggttgatgttact
ttgctagctgtccccagtgaaaaagccttctttcaagctctagaatgtacgagaaaaggc
ggcaaaatcttgtttttcgccgaatttccagacgaattagaaattcccattaacccaaat
attctttatcgtcgagaaatcgacctaatgggcagttacagttcatcctatcgcctccaa
aatctctcagctgatatcgtctttaatcgccgcatcgatgtgcaagcattaattagcgat
cgctatcccctaaaagatttatcagccgcagtagatcaagcgatcgcacccacaccagaa
acttacaaaattctgatttatccgaaaattggggattag

DBGET integrated database retrieval system