KEGG   Nostoc sp. PCC 7120: alr2938Help
Entry
alr2938           CDS       T00069                                 

Gene name
sodB
Definition
(GenBank) iron superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ana  Nostoc sp. PCC 7120
Brite
Enzymes [BR:ana01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     alr2938 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Peptidase_C107
Motif
Other DBs
NCBI-ProteinID: BAB74637
CyanoBase: alr2938
CYORF: alr2938
UniProt: Q8YSZ1
LinkDB All DBs
Position
3576003..3576605
Genome map
AA seq 200 aa AA seqDB search
MAFVQEPLPYDFNALEQYGMKGETFEYHYGKHHKAYVDNLNKLTDGTELADKSLEEVIQI
AFKDASKAGIFNNAAQVWNHTFFWNSLKPAGGGAPTGEFAAKINQDFGSFDKLKEEFSNA
AATQFGSGWAWLIDDGGTLKVTKTPNAENPLAHGQKALLTLDVWEHAYYIDFRNARPAFI
KNYLDNLVNWDFAAANYAKA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgtacaggaaccactaccctacgactttaatgctttagagcagtatggcatg
aaaggtgaaaccttcgagtatcactacggcaaacatcacaaagcttatgtagataacctg
aacaagctcaccgatggtacagaattggctgataaatccttagaagaagtcatccaaatt
gcctttaaggatgcctctaaagctggaatctttaacaacgctgctcaagtgtggaaccac
accttcttctggaattctttaaagcccgcaggtggcggcgcgcctacaggtgaattcgca
gccaaaattaaccaagactttggtagcttcgacaaattgaaagaagaattttccaacgct
gctgcaactcagttcggtagcggatgggcttggctaattgatgatggcggtacactgaaa
gtcactaaaactccaaacgccgaaaatcccctggctcatggacaaaaagcactcttaacc
ttggatgtctgggaacacgcctactacatcgacttcagaaatgctcgcccagcttttatc
aagaactacttagataacttggttaactgggactttgctgctgcgaattatgctaaagct
tag

DBGET integrated database retrieval system