KEGG   Nostoc sp. PCC 7120: alr3606Help
Entry
alr3606           CDS       T00069                                 

Definition
(GenBank) dihydrolipoamide S-acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ana  Nostoc sp. PCC 7120
Pathway
ana00010  Glycolysis / Gluconeogenesis
ana00020  Citrate cycle (TCA cycle)
ana00620  Pyruvate metabolism
ana01100  Metabolic pathways
ana01110  Biosynthesis of secondary metabolites
ana01120  Microbial metabolism in diverse environments
ana01130  Biosynthesis of antibiotics
ana01200  Carbon metabolism
Module
ana_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ana00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    alr3606
   00020 Citrate cycle (TCA cycle)
    alr3606
   00620 Pyruvate metabolism
    alr3606
Enzymes [BR:ana01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     alr3606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: BAB75305
CyanoBase: alr3606
CYORF: alr3606
UniProt: Q8YR44
LinkDB All DBs
Position
4356210..4357502
Genome map
AA seq 430 aa AA seqDB search
MSIHEIFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVETFYEGFLAHI
IVEAGDSAPVGAAIAYVAETEAEIEAAKSLGSSGAAAATPPAAPQPVATTAAVGVPATSQ
NGSNHREGRLIASPRARKLAKELKVDLTSLKGSGPYGRIVADDIESAVGKVKQPATTPSA
PTPTFTPAAPPAPRTPAPAPAPIAAAPGQVVPFNTLQNAVIRNMVASLDVPVFRVGYTIT
TDGLDKLYKQIKSKGVTMTALLAKAVAVTLQKHPLLNASYSDQGLVYHPDINVAVAVAMD
GGGLITPVLKNADKIDIYSLSRTWKSLVDKARSKQLQPDEYTGGNFTLSNLGMFGVDTFD
AILPPGQGSILAIGASRPQLVATGDGLFGVKQQMQVNITSDHRIIYGADAAAFLQDLAKL
IETDAQSLTL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgagcattcacgaaatcttcatgccggcgctgagttccaccatgaccgaaggcaaaatt
gtctcctgggtgaaatcgccaggcgataaagtggaaaaaggcgaaacagtggtggttgtc
gagtcagacaaagcagatatggatgtagaaaccttttatgaaggttttctcgcccacatc
attgtagaagctggtgatagcgcacctgtaggagctgcgatcgcttacgtagcggaaacc
gaagccgaaatcgaagccgctaagtctttaggcagttctggtgctgctgcggctacccct
ccggccgcccctcaaccagtcgcaactaccgccgccgtaggtgtaccagccacatcacaa
aatggctctaaccaccgtgagggtaggcttatagcttcaccccgcgcccgcaaattggca
aaagaactgaaagttgatttgacaagtctcaaaggtagtggcccctacggtcgcattgtt
gccgatgacatagaatctgctgttggtaaagtcaagcaaccagccacgacaccatctgca
cccacacccacctttaccccagccgcacccccagcaccccgcactccagcaccagcgcct
gcaccaatagcggctgcacctgggcaagtagtaccatttaataccctacaaaacgctgtc
attcgcaacatggtggcgagccttgatgtacccgtgttccgtgtgggttacacaatcacc
accgatggcttagacaaactttacaaacaaattaaatccaaaggcgtaaccatgacagcg
ctactggcgaaagctgtggcggtgacattacaaaaacatcctttattaaatgccagctat
tcagatcaaggtcttgtttatcatcctgacatcaatgttgcggtagctgtagcgatggat
ggtggcggtttaattacaccagtgttaaaaaatgccgacaagatagatatctactcccta
tcacgtacttggaaatctctagtagacaaagccaggagcaaacaactacaaccagacgaa
tacactggtggtaattttaccctgtcaaacttggggatgtttggtgtcgatacatttgat
gccattttacccccaggacaaggttcaattttagcgatcggtgcatctcgtccccaattg
gtagctacaggcgatggtttatttggtgtcaaacaacaaatgcaggtaaatattacatct
gatcaccggattatttacggtgctgatgctgccgcatttttacaagatttagccaagttg
attgaaactgatgctcaatctttgacactgtaa

DBGET integrated database retrieval system