KEGG   Nostoc sp. PCC 7120: alr3606
Entry
alr3606           CDS       T00069                                 

Definition
(GenBank) dihydrolipoamide S-acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ana  Nostoc sp. PCC 7120
Pathway
ana00010  Glycolysis / Gluconeogenesis
ana00020  Citrate cycle (TCA cycle)
ana00620  Pyruvate metabolism
ana01100  Metabolic pathways
ana01110  Biosynthesis of secondary metabolites
ana01120  Microbial metabolism in diverse environments
ana01200  Carbon metabolism
Module
ana_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ana00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    alr3606
   00020 Citrate cycle (TCA cycle)
    alr3606
   00620 Pyruvate metabolism
    alr3606
Enzymes [BR:ana01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     alr3606
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Other DBs
NCBI-ProteinID: BAB75305
CyanoBase: alr3606
CYORF: alr3606
UniProt: Q8YR44
LinkDB
Position
4356210..4357502
AA seq 430 aa
MSIHEIFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVETFYEGFLAHI
IVEAGDSAPVGAAIAYVAETEAEIEAAKSLGSSGAAAATPPAAPQPVATTAAVGVPATSQ
NGSNHREGRLIASPRARKLAKELKVDLTSLKGSGPYGRIVADDIESAVGKVKQPATTPSA
PTPTFTPAAPPAPRTPAPAPAPIAAAPGQVVPFNTLQNAVIRNMVASLDVPVFRVGYTIT
TDGLDKLYKQIKSKGVTMTALLAKAVAVTLQKHPLLNASYSDQGLVYHPDINVAVAVAMD
GGGLITPVLKNADKIDIYSLSRTWKSLVDKARSKQLQPDEYTGGNFTLSNLGMFGVDTFD
AILPPGQGSILAIGASRPQLVATGDGLFGVKQQMQVNITSDHRIIYGADAAAFLQDLAKL
IETDAQSLTL
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgagcattcacgaaatcttcatgccggcgctgagttccaccatgaccgaaggcaaaatt
gtctcctgggtgaaatcgccaggcgataaagtggaaaaaggcgaaacagtggtggttgtc
gagtcagacaaagcagatatggatgtagaaaccttttatgaaggttttctcgcccacatc
attgtagaagctggtgatagcgcacctgtaggagctgcgatcgcttacgtagcggaaacc
gaagccgaaatcgaagccgctaagtctttaggcagttctggtgctgctgcggctacccct
ccggccgcccctcaaccagtcgcaactaccgccgccgtaggtgtaccagccacatcacaa
aatggctctaaccaccgtgagggtaggcttatagcttcaccccgcgcccgcaaattggca
aaagaactgaaagttgatttgacaagtctcaaaggtagtggcccctacggtcgcattgtt
gccgatgacatagaatctgctgttggtaaagtcaagcaaccagccacgacaccatctgca
cccacacccacctttaccccagccgcacccccagcaccccgcactccagcaccagcgcct
gcaccaatagcggctgcacctgggcaagtagtaccatttaataccctacaaaacgctgtc
attcgcaacatggtggcgagccttgatgtacccgtgttccgtgtgggttacacaatcacc
accgatggcttagacaaactttacaaacaaattaaatccaaaggcgtaaccatgacagcg
ctactggcgaaagctgtggcggtgacattacaaaaacatcctttattaaatgccagctat
tcagatcaaggtcttgtttatcatcctgacatcaatgttgcggtagctgtagcgatggat
ggtggcggtttaattacaccagtgttaaaaaatgccgacaagatagatatctactcccta
tcacgtacttggaaatctctagtagacaaagccaggagcaaacaactacaaccagacgaa
tacactggtggtaattttaccctgtcaaacttggggatgtttggtgtcgatacatttgat
gccattttacccccaggacaaggttcaattttagcgatcggtgcatctcgtccccaattg
gtagctacaggcgatggtttatttggtgtcaaacaacaaatgcaggtaaatattacatct
gatcaccggattatttacggtgctgatgctgccgcatttttacaagatttagccaagttg
attgaaactgatgctcaatctttgacactgtaa

DBGET integrated database retrieval system