KEGG   Anabaena sp. 90: ANA_C20360Help
Entry
ANA_C20360        CDS       T02341                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
anb  Anabaena sp. 90
Pathway
anb00010  Glycolysis / Gluconeogenesis
anb00020  Citrate cycle (TCA cycle)
anb00620  Pyruvate metabolism
anb01100  Metabolic pathways
anb01110  Biosynthesis of secondary metabolites
anb01120  Microbial metabolism in diverse environments
anb01130  Biosynthesis of antibiotics
anb01200  Carbon metabolism
Module
anb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:anb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANA_C20360
   00020 Citrate cycle (TCA cycle)
    ANA_C20360
   00620 Pyruvate metabolism
    ANA_C20360
Enzymes [BR:anb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ANA_C20360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase
Motif
Other DBs
NCBI-ProteinID: AFW96804
UniProt: K7WAA2
LinkDB All DBs
Position
chANA02:399513..400802
Genome map
AA seq 429 aa AA seqDB search
MSINEVFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVETFYEGYLAHI
IVPAGETAPVGTAIAYIAETEAEIATAQSLANADGAAAPSTPAPVPAAAIAAPATPSQNG
SNHEPGRVVVSPRARKLAKELKVDLNTLTGSGPYGRIVAEDIEVAVGKVQPVTTPVVTPA
PAPVAAPVPVAAPAPVATPVVSSAVPGQVVPFTTLQNAVVRGMVASLSVPVFRVSYTIST
DGLDKLYKQIKSKGVTMTALLAKAVAITLQKHPILNASYSDQGIVNHPNINVSVAVAMDD
GGLITPVLQNADAVDIYSLSRNWKSLVERARAKQLQPVEYNSGTFTLSNLGMFGVDTFDA
ILPPGQGSILAIGASRPQVVATPDGLFGVRQQMQVTITCDHRIIYGADAAGFLQDLAKLI
ETNPQSLTM
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagcattaacgaagtatttatgccagcgctgagttccaccatgaccgaaggcaaaatt
gtctcctgggtcaagtcgcctggagataaagtggagaaaggcgaaacagtggtggttgtc
gaatcagataaagctgatatggacgtggaaaccttctatgaaggatatcttgcccatatc
attgttcccgctggtgaaaccgccccagtcggcacagcgatcgcatacattgccgaaaca
gaagcagaaatagccacagcccagtccttagccaacgcagacggtgctgctgccccctcc
acacctgcccccgtacccgctgccgccattgccgcccctgccaccccatctcaaaatggt
tctaaccatgaacccggcagagtcgtcgtttcaccccgcgctcgcaaactagccaaagaa
ctcaaagttgatttaaataccctcacaggtagcggtccctacggtcgtattgtggcggaa
gatatagaagtggcagtcggtaaagttcaacccgttactacccccgttgtcactcccgca
cctgcacctgtagccgcacctgtacccgtagctgcacctgcacctgttgccacaccagta
gttagtagtgccgttcctggtcaagtagtaccattcacaaccttacaaaatgccgtagtt
cggggcatggtagccagtttatctgtacctgtgttccgtgtcagttacacaattagcacc
gatggactcgataaactttacaaacaaattaagtctaaaggtgtgacaatgaccgcgcta
ttagccaaagctgtagccataacattacaaaaacaccccatccttaatgccagctactca
gatcaaggaattgtcaatcaccctaatattaacgtttctgttgccgtagccatggatgat
ggtggtttaatcacacccgttttacaaaatgcagatgcagttgatatctactctttatct
cgcaattggaaatctttagtagaacgcgctagagctaaacaactacaaccagtagaatat
aacagcggtacttttacactttccaacttaggaatgtttggtgtagatacctttgatgcc
attttaccccccggacaaggttctattttagccattggtgcatcacgtccccaagtagtt
gccacacctgatggattatttggtgtgcgtcaacaaatgcaagttacaatcacctgtgat
catcgcattatttacggcgctgatgctgccggattcttgcaagacttagcgaagttgatt
gaaacgaatccccaatctttgacaatgtaa

DBGET integrated database retrieval system