KEGG   Anabaena sp. 90: ANA_C20360
Entry
ANA_C20360        CDS       T02341                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
anb  Anabaena sp. 90
Pathway
anb00010  Glycolysis / Gluconeogenesis
anb00020  Citrate cycle (TCA cycle)
anb00620  Pyruvate metabolism
anb01100  Metabolic pathways
anb01110  Biosynthesis of secondary metabolites
anb01120  Microbial metabolism in diverse environments
anb01200  Carbon metabolism
Module
anb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:anb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANA_C20360
   00020 Citrate cycle (TCA cycle)
    ANA_C20360
   00620 Pyruvate metabolism
    ANA_C20360
Enzymes [BR:anb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ANA_C20360
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase
Other DBs
NCBI-ProteinID: AFW96804
UniProt: K7WAA2
LinkDB
Position
chANA02:399513..400802
AA seq 429 aa
MSINEVFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVETFYEGYLAHI
IVPAGETAPVGTAIAYIAETEAEIATAQSLANADGAAAPSTPAPVPAAAIAAPATPSQNG
SNHEPGRVVVSPRARKLAKELKVDLNTLTGSGPYGRIVAEDIEVAVGKVQPVTTPVVTPA
PAPVAAPVPVAAPAPVATPVVSSAVPGQVVPFTTLQNAVVRGMVASLSVPVFRVSYTIST
DGLDKLYKQIKSKGVTMTALLAKAVAITLQKHPILNASYSDQGIVNHPNINVSVAVAMDD
GGLITPVLQNADAVDIYSLSRNWKSLVERARAKQLQPVEYNSGTFTLSNLGMFGVDTFDA
ILPPGQGSILAIGASRPQVVATPDGLFGVRQQMQVTITCDHRIIYGADAAGFLQDLAKLI
ETNPQSLTM
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgagcattaacgaagtatttatgccagcgctgagttccaccatgaccgaaggcaaaatt
gtctcctgggtcaagtcgcctggagataaagtggagaaaggcgaaacagtggtggttgtc
gaatcagataaagctgatatggacgtggaaaccttctatgaaggatatcttgcccatatc
attgttcccgctggtgaaaccgccccagtcggcacagcgatcgcatacattgccgaaaca
gaagcagaaatagccacagcccagtccttagccaacgcagacggtgctgctgccccctcc
acacctgcccccgtacccgctgccgccattgccgcccctgccaccccatctcaaaatggt
tctaaccatgaacccggcagagtcgtcgtttcaccccgcgctcgcaaactagccaaagaa
ctcaaagttgatttaaataccctcacaggtagcggtccctacggtcgtattgtggcggaa
gatatagaagtggcagtcggtaaagttcaacccgttactacccccgttgtcactcccgca
cctgcacctgtagccgcacctgtacccgtagctgcacctgcacctgttgccacaccagta
gttagtagtgccgttcctggtcaagtagtaccattcacaaccttacaaaatgccgtagtt
cggggcatggtagccagtttatctgtacctgtgttccgtgtcagttacacaattagcacc
gatggactcgataaactttacaaacaaattaagtctaaaggtgtgacaatgaccgcgcta
ttagccaaagctgtagccataacattacaaaaacaccccatccttaatgccagctactca
gatcaaggaattgtcaatcaccctaatattaacgtttctgttgccgtagccatggatgat
ggtggtttaatcacacccgttttacaaaatgcagatgcagttgatatctactctttatct
cgcaattggaaatctttagtagaacgcgctagagctaaacaactacaaccagtagaatat
aacagcggtacttttacactttccaacttaggaatgtttggtgtagatacctttgatgcc
attttaccccccggacaaggttctattttagccattggtgcatcacgtccccaagtagtt
gccacacctgatggattatttggtgtgcgtcaacaaatgcaagttacaatcacctgtgat
catcgcattatttacggcgctgatgctgccggattcttgcaagacttagcgaagttgatt
gaaacgaatccccaatctttgacaatgtaa

DBGET integrated database retrieval system