KEGG   Actinomyces naeslundii: AN27039_0014Help
Entry
AN27039_0014      CDS       T05566                                 

Definition
(GenBank) aspartyl-tRNA(Asn) amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
ane  Actinomyces naeslundii
Pathway
ane00970  Aminoacyl-tRNA biosynthesis
ane01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ane00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AN27039_0014
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ane03029]
    AN27039_0014
Enzymes [BR:ane01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AN27039_0014
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AN27039_0014
Mitochondrial biogenesis [BR:ane03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AN27039_0014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: BAV83084
UniProt: A0A2I1JQ78
LinkDB All DBs
Position
complement(17557..17862)
Genome map
AA seq 101 aa AA seqDB search
MSAISTDEVARVAALARVALSDEEVSRLAGELDAVASSFARVTSVVTPDLPATSHPVPLT
NVLREDVPAPTLDVDELLAGAPASEDSMFLVPQILGEDSAS
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctatttccactgatgaggtcgcacgtgtcgcggcactggctcgggtcgccctg
agcgatgaggaggtgtcgcgcctggccggagagctggacgcggtcgcctcctccttcgcc
agggtcacgagcgtggtcacgcccgacctgcctgcgacctcccaccccgtgcccctgacc
aacgtgctgcgtgaggacgttccggcccccacgctcgacgtcgacgagctcctggccggc
gcgccggccagcgaggactccatgttcctcgttccgcagatcctgggggaggactccgcc
tcatga

DBGET integrated database retrieval system