KEGG   Actinomyces naeslundii: AN27039_1972Help
Entry
AN27039_1972      CDS       T05566                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ane  Actinomyces naeslundii
Pathway
ane00010  Glycolysis / Gluconeogenesis
ane00030  Pentose phosphate pathway
ane00051  Fructose and mannose metabolism
ane00052  Galactose metabolism
ane00680  Methane metabolism
ane01100  Metabolic pathways
ane01110  Biosynthesis of secondary metabolites
ane01120  Microbial metabolism in diverse environments
ane01130  Biosynthesis of antibiotics
ane01200  Carbon metabolism
ane01230  Biosynthesis of amino acids
ane03018  RNA degradation
Module
ane_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ane00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AN27039_1972
   00030 Pentose phosphate pathway
    AN27039_1972
   00051 Fructose and mannose metabolism
    AN27039_1972
   00052 Galactose metabolism
    AN27039_1972
  09102 Energy metabolism
   00680 Methane metabolism
    AN27039_1972
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    AN27039_1972
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ane01009]
    AN27039_1972
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ane03019]
    AN27039_1972
Enzymes [BR:ane01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AN27039_1972
Protein phosphatases and associated proteins [BR:ane01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AN27039_1972
Messenger RNA biogenesis [BR:ane03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     AN27039_1972
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Proteasome DAGK_cat
Motif
Other DBs
NCBI-ProteinID: BAV85042
UniProt: A0A2Z5QRF7
LinkDB All DBs
Position
complement(1862543..1864918)
Genome map
AA seq 791 aa AA seqDB search
MPAAMSSDTADTVPSPTGSSAGPLLGLDGEPLRIGVLTSGGDAQGMNAAVRAVVRTAIRL
GARPYAVMEGWAGAVAGGDGIRPLEWDSVGSILQRGGTIIGTARSAEFRERAGQLAAARN
LLEHGIDRLVVIGGDGSLTGTNEFRKNWPSLLEELVETGDISAETAAAHPVLMVTGLVGS
IDNDLVGADMTIGTDSALHRILEAIDDISSTAASHQRTFVVEVMGRHCGYLALMAAVAGG
CDYVLVPELPPGKDWEEDMCSKLKAGREAGRRESMVIVAEGATDREGNRITADDVRQVIA
DKLGEAARVTILGHVQRGGRPSAYDRWMSTLLGCAAAREVVSMEPGSEPVIIAERHNRIR
RLPMMEQIAATRAVKDLVAAHDYLGAVQARGASFGRMLELFETMSTPPAEPATDTGSTPS
TSDRPKRVAIIHAGGLAPGMNTAARAAVRLGIDHDFTMLGVYGGFPGLLDGDVRELTWAD
VEGWVGDGGAQLGTRREVPTIEQLYALGRAIELHEIDALLVIGGYNAYLSAYRLVTERDR
YPAFQIPIVCVPASIDNNLPGSELSIGTDTALNNAVVALDSIKLSAAASHRCFVAEVMGR
KCGYLSLMSGLATGAEKVYLNEEGITLAGLAADSERMVESFRSGRSLYLVIRNERASVNY
TTDVLAHIFAEEGKGLYDVREAILGHQQQGGSPTAFDRIMATKLVAHSLELLACALKRGE
PTASYVGLMGGKVSDQPLDRMNDDLDRDHRRPRHQWWLGLRPAVGLVSQDIGTLTLQDVP
DFGEAVDDAAS
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgccagccgccatgtcctcagacaccgcagacactgtcccctcccccaccggctcgtcg
gccggcccgctgctcggcctggacggcgagcccctgcgcatcggggtcctcacttccggc
ggtgacgcccagggcatgaacgcggccgtgcgggccgtggtccgcaccgccatccgcctg
ggggccaggccctacgcggtcatggagggctgggccggggccgtggccgggggtgacggc
atccgtcccctggagtgggactcggtgggctccatcctccagcgcggcggcaccatcatc
ggcaccgcccgctcggccgagttccgcgagcgcgccggccagctggcggccgctcgcaac
ctgctggagcacggcatcgaccgactcgtggtcatcggcggcgacggctctctaaccggc
accaacgagttccgcaagaactggccctccctgctcgaggagctcgtcgagaccggtgac
atcagtgcggagacggccgccgcccatcccgtcctcatggtgaccggcctggtgggcagc
atcgacaacgacctcgtgggcgccgacatgaccatcggcaccgactccgccctccaccgc
atcctggaggccatcgacgacatctcctcaacggccgcctcccaccagcgcaccttcgtc
gtggaggtcatgggccgccactgcggctacctggccctcatggcggccgtggccgggggc
tgtgactacgtcctggtccctgagctccccccgggcaaggactgggaggaggacatgtgc
tccaagctcaaggcgggcagagaggccgggcgccgcgagtccatggtgatcgtcgccgag
ggcgccaccgaccgcgagggcaaccgcatcaccgccgacgacgtccgccaggtcatcgcc
gacaagctgggtgaggccgcccgtgtcaccatcctggggcacgtccagcgcggtggccgc
cccagcgcctacgaccgctggatgtccacgctgttgggctgcgctgccgcccgtgaggtg
gtgtccatggagccgggcagcgagccggtcatcatcgccgagcgccacaaccgcatccgc
cgtctgccgatgatggagcagatcgcggccacgcgcgctgtcaaggatctcgtggccgcc
cacgactacctcggggcggtccaggcccgcggggcgagcttcggcaggatgctcgagctg
ttcgagaccatgtccacgcctcccgccgagccggccactgacacgggatcgacgccgtcg
acctccgaccgccccaagcgggtcgccatcatccacgccggcggcctggccccggggatg
aacacggcggcgcgtgcggccgtgcgcctgggcatcgaccacgacttcacgatgctgggc
gtctacggcggcttccccggcctgctggacggcgacgtgcgcgagctgacctgggccgac
gtcgagggctgggtcggtgatggcggcgcccagctgggcacgcgccgcgaggtgcccacc
attgagcagctctacgcgctggggcgggccatcgagctccatgagatcgacgccctgctg
gtcatcggcggctacaacgcctacctgagcgcctaccgcctggtcaccgagcgggaccgc
taccccgccttccagatcccgatcgtgtgcgtgccggcctccatcgacaacaacctgccc
ggctccgagctgagcatcggcaccgacacggccctcaacaacgcggtggtggcactggac
tccatcaagctctccgcggcggcctcccaccgctgcttcgtcgccgaggtcatgggccgc
aagtgcggctacctgtccctgatgtcgggcctggccaccggcgcggagaaggtctacctc
aacgaggagggcatcacgctggcgggcctggcagcggactccgagcggatggtggagtcc
ttccgctcgggccgcagcctctacctggtgatccgcaacgagcgggccagcgtcaactac
accaccgacgtcctggcccacatcttcgccgaggagggcaagggcctctacgacgtgcgc
gaggcgatcctgggtcaccagcagcagggaggcagccccacggccttcgaccggatcatg
gcgaccaagctagtcgcccactccctggaactgctggcctgcgcactcaagcgcggtgag
ccgacggcctcctacgtgggcctgatggggggcaaggtctccgaccagcccctggaccgc
atgaacgacgacctcgaccgcgaccaccgtcgcccccgccaccagtggtggctgggtctg
cgccccgccgtgggcctggtcagccaggacatcgggaccctgacgcttcaggacgtgccc
gacttcggtgaggcggtcgacgacgcggccagctga

DBGET integrated database retrieval system