KEGG   Actinomyces naeslundii: AN27039_2603Help
Entry
AN27039_2603      CDS       T05566                                 

Definition
(GenBank) shikimate kinase I
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
ane  Actinomyces naeslundii
Pathway
ane00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ane01100  Metabolic pathways
ane01110  Biosynthesis of secondary metabolites
ane01130  Biosynthesis of antibiotics
ane01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ane00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AN27039_2603
Enzymes [BR:ane01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     AN27039_2603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_17 CPT AAA_18 AAA AAA_33 Cytidylate_kin
Motif
Other DBs
NCBI-ProteinID: BAV85673
UniProt: A0A2Z5QTC8
LinkDB All DBs
Position
2468069..2468635
Genome map
AA seq 188 aa AA seqDB search
MSATAPGSLILIGPPGAGCSSVARAIGSAQGLPVLDLGQLVADELGTRPELALVAVAETE
YRRIEAGTAERLLERAETGGLVVALGSGCLEARGVRQGLERLRLAGRSTHHVVALTCATR
VLATRNGLDAPRSVALGTVHHQFVQMLHERHTLCRDMADVVIDTTATTPDEAAQKVMNDI
GTDLSRHS
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgccacggcaccgggttccctcatcctcatcggcccgcccggtgccggctgctcc
agcgtggcccgtgccatcgggagtgcccagggccttcccgtgctcgatctgggccagctc
gtcgccgatgagctgggaactcgccccgagctggcgctcgtcgcggtggcggagaccgag
taccgccgcatcgaggccggcaccgctgaacggctcctggagcgggccgagaccgggggc
ctcgtcgtcgccctgggatcgggctgcctggaggccaggggagtgcgtcagggcctcgag
cgtctcaggctcgccggccgcagtactcaccacgtcgtggccctgacctgtgctacccgg
gtcctggccactcgtaacggtcttgacgcgccgcggtccgtggccctgggaaccgtccat
caccagttcgtccagatgctccacgagcgccacaccctgtgccgggacatggccgacgtc
gtcatcgacaccaccgcgacgacccccgacgaggccgctcagaaggtgatgaacgacatc
ggcaccgatttgtcccgccactcgtga

DBGET integrated database retrieval system