KEGG   Actinomyces naeslundii: AN27039_3061Help
Entry
AN27039_3061      CDS       T05566                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ane  Actinomyces naeslundii
Pathway
ane00473  D-Alanine metabolism
ane00550  Peptidoglycan biosynthesis
ane01100  Metabolic pathways
ane01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ane00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AN27039_3061
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AN27039_3061
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AN27039_3061
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ane01011]
    AN27039_3061
Enzymes [BR:ane01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AN27039_3061
Peptidoglycan biosynthesis and degradation proteins [BR:ane01011]
 Precursor biosynthesis
  Amino acid ligase
   AN27039_3061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_N Dala_Dala_lig_C CPSase_L_D2 ATP-grasp_4 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: BAV86131
UniProt: A0A2Z5QUQ4
LinkDB All DBs
Position
complement(2883890..2885227)
Genome map
AA seq 445 aa AA seqDB search
MTALQEAGPSVPSSDKSTVRVAVVFGGRSGEHTISCATAAGVLSAIDRNRYEVLPVGITP
EGQWLLVEDDPAALELSDNRPPVTITAEGLGRGRLTAPLGGGELTVLGPTGPEVLGQVDV
VLPLLHGPYGEDGTIQGMLEMMGIPYVGCGVLASAAGMDKQVTKVLLGAAGIATAPHVVV
GPHAWKRDPEAILEACRSLTYPLFVKPARAGSSLGISKVDRPEDLAGAIEAARAVDPKVL
VESGIVGREVEVAVLQGRGDDAPEWPSPARSPWTPPRAPASSTTTRLSTWPTTLWPWCAR
RASALRRARSSWTPRPGPSRRSAARGWLGSTSSSLRSARRWSTRSTRCPVSPPSPCTPTC
GRSPAWATPSWSLSSLSWPWLDPPMSTAEQATSGAEAVGQDARVGDLSEEELLAVITPSC
PAARRPPSARGTTARSCPSPTHLRR
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgacagccctccaggaagccggcccctccgtgcccagttctgacaagtccaccgtgcgt
gtcgccgtcgtcttcggtgggcgcagtggtgagcacacgatctcctgcgccaccgcagcc
ggcgtcctgtcagccattgaccgcaaccgttacgaggtccttccggtgggcatcacgccc
gagggccagtggctgctcgtcgaggacgatccggccgccctcgagctcagcgacaaccgc
cccccggtgaccatcaccgccgagggcttgggacgcgggaggctcaccgcacccctggga
ggcggcgagctcacggtcctcggtcccacggggcctgaggtcctggggcaggtcgacgtc
gtcctgccgctgctgcacgggccctacggcgaggacggaaccatccagggcatgctggag
atgatgggcattccctacgtcggctgcggggtgctggccagcgccgcgggcatggacaag
caggtcactaaggtgctcctgggggccgcgggcatcgccacggcgccgcacgtcgtcgtc
ggtccccatgcctggaagcgggaccccgaggcgatcctggaggcctgtcggtccctgacc
taccccctgttcgtcaagcccgcccgtgccggctcctccctgggcatcagcaaggtcgac
cgccctgaggacctggccggagccatcgaggcggcccgcgcggtcgatcccaaggtcctc
gtggagagcggcatcgtgggacgagaggtcgaggtcgccgtccttcagggccgcggcgac
gacgcccccgagtggccgagcccggcgagatcgccatggacgcctcccagggcgccggcg
agttctacgactacgagactaagtacctggcccacgacgctgtggccatggtgtgcccgg
cgcgcatcagccctgaggcgcgcgcgctcctcatggacaccgcggcccgggccttcgagg
cggtcggctgcgaggggctggctcgggtcgacttcttcctcactgaggtcggcgaggcgg
tggtcaacgagatcaacacgatgcccggtttcacccccttctccatgtacccctacatgt
ggcaggtctccggcctgggctacaccgagctggtctctgagctcattgagctggccgtgg
ctcgatccaccgatgtcaaccgctgagcaggccacatccggcgcagaggccgtggggcag
gacgcgcgggtcggtgacctcagcgaggaggagctccttgccgtcatcaccccctcctgc
cccgcggcccgcagacccccgtcggcacgggggacgactgcgcggtcctgtccttccccg
actcacttacggcggtga

DBGET integrated database retrieval system