KEGG   Aspergillus niger: ANI_1_1030104Help
Entry
ANI_1_1030104     CDS       T01030                                 

Gene name
An12g08610
Definition
(RefSeq) glucokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ang  Aspergillus niger
Pathway
ang00010  Glycolysis / Gluconeogenesis
ang00051  Fructose and mannose metabolism
ang00052  Galactose metabolism
ang00500  Starch and sucrose metabolism
ang00520  Amino sugar and nucleotide sugar metabolism
ang01100  Metabolic pathways
ang01110  Biosynthesis of secondary metabolites
ang01130  Biosynthesis of antibiotics
ang01200  Carbon metabolism
Module
ang_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ang_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ang00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANI_1_1030104 (An12g08610)
   00051 Fructose and mannose metabolism
    ANI_1_1030104 (An12g08610)
   00052 Galactose metabolism
    ANI_1_1030104 (An12g08610)
   00500 Starch and sucrose metabolism
    ANI_1_1030104 (An12g08610)
   00520 Amino sugar and nucleotide sugar metabolism
    ANI_1_1030104 (An12g08610)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    ANI_1_1030104 (An12g08610)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ang04131]
    ANI_1_1030104 (An12g08610)
Enzymes [BR:ang01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     ANI_1_1030104 (An12g08610)
Membrane trafficking [BR:ang04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    ANI_1_1030104 (An12g08610)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 4986212
NCBI-ProteinID: XP_001395912
UniProt: A2R0H3
LinkDB All DBs
AA seq 495 aa AA seqDB search
MSSALLDEAARIARQFDYPAAEVQRGVTEYIREIDEGLSKEHTTLSQIPTYVTAVPNGTE
KGLYLAVDLGGTNFRVCSIDLHGDTTFSLTQSKIMIPRETMASGTAKDLFLFLARQIESF
LRIHHNDHFEAHLRRRNEKNGNCEEDLFDLGFTFSFPVRQLGINKGTLIRWTKGFNIPDA
VGKDVCALLQNAIDDLGLPVRVAALVNDTVGTLMARSYTSPGETGTFLGAIFGTGTNGAY
VEKLDRITKLQTIEHSEYDKTTGEMIINAEWGSFDNHLSVLPNTIYDQQLDADSNNPGIQ
MFEKRVSGMFLGEILRRVMLDMQRNESLGFLRAGGASTVSVPQESSLYRQWGIDTSLLSL
VEADKTENMEQIKVALKDHLKIERPTTDDCKAIQTVVHAIGKRAARLSAVPLAAILLSTG
KLQKDDLVDIGVDGSLVEFYPNFEGYMRDALREVPEVGEAGNKKIRIGISKDGSGVGAAL
IALVASKEEARRKSQ
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctgctctccttgacgaggctgcgcgcattgcccgccagttcgactaccccgct
gctgaggtgcagcgtggagtgacggaatacattcgtgagatcgatgaaggtttgtccaag
gagcacacgaccctcagtcagatccctacctatgtcacggcggtgcccaatggcacggaa
aagggattgtacctggcagtagatctcggcggcaccaacttccgcgtgtgttcgatcgat
ctacatggagacactaccttctcccttacccagtccaagatcatgattcctcgtgagacc
atggcgtccggtacggccaaggatctcttcttgttcttggcccgccaaatcgaatcgttc
ctgcgcattcaccacaacgaccacttcgaagctcacctgcgacgccgcaatgagaagaat
ggcaactgtgaagaggacctgttcgacttgggtttcaccttcagtttccccgtgcgtcag
ctgggcattaacaagggtaccctgattcgctggacgaagggcttcaacattcccgatgcg
gtgggtaaggatgtctgcgcattgctgcagaacgccatcgatgatctgggcctcccggtg
cgcgtggctgccttggtcaacgacactgtcggaaccctgatggctcgttcatacacctct
cctggagagacgggcacgttcctgggtgctatctttggcacgggcaccaatggcgcctat
gttgagaagctggaccggatcactaagctgcagaccattgaacactccgagtacgacaag
accaccggtgagatgattatcaacgccgagtggggcagcttcgacaaccacctgagtgta
ctgccgaacaccatctacgaccagcagctcgatgccgacagcaacaaccccggcattcaa
atgttcgagaagcgtgtctcgggtatgttcctgggtgagatcttgcgccgcgtcatgctg
gacatgcagcgcaacgagtccctgggcttcctccgggctggcggcgcttccaccgtttct
gttccccaggagtcctccctgtaccgccaatggggtattgacaccagcttgttgagtctg
gtcgaggccgacaagactgagaatatggagcagatcaaggtcgctctgaaggatcacctc
aagatcgaacgccccaccaccgacgactgcaaggccatccagaccgttgttcatgccatt
ggcaagcgtgctgctcgtctgagtgccgtcccgctggctgccatcctcctctctactggc
aagctgcagaaggatgacctcgtagacattggtgtggatggcagtctggtcgagttctac
cccaacttcgaaggctacatgcgtgatgccctccgcgaagtgcccgaggttggagaagcc
ggcaacaagaagatccgcattggtatctccaaggatggcagcggcgtgggtgctgctcta
atcgccctcgttgctagcaaggaggaggcccgcagaaagtcgcaatag

DBGET integrated database retrieval system